KEGG   Escherichia coli K-12 MDS42: ECMDS42_2295Help
Entry
ECMDS42_2295      CDS       T02541                                 

Gene name
yqcB
Definition
(GenBank) tRNA pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ecok  Escherichia coli K-12 MDS42
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecok03016]
    ECMDS42_2295 (yqcB)
Enzymes [BR:ecok01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ECMDS42_2295 (yqcB)
Transfer RNA biogenesis [BR:ecok03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    ECMDS42_2295 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BAL39494
Position
complement(2433537..2434319)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgcagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gaccagataggccagcatgtttttactgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggctggttgatggaagaagcggtgctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggcccgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaaccggacgc
aaacatcagcttcgccgacatcttgcccatttgcgtcatccgattattggcgatagcaaa
catggcgatttacgccagaatcgcagcggtgctgagcattttggcctccagcggttaatg
ctacatgccagtcagttgtcattgacgcatccttttactggcgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system