KEGG   Escherichia coli K-12 MDS42: ECMDS42_2368
Entry
ECMDS42_2368      CDS       T02541                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00230  Purine metabolism
ecok01100  Metabolic pathways
ecok01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECMDS42_2368 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: BAL39558
Position
2510147..2510626
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system