KEGG   Escherichia coli K-12 MDS42: ECMDS42_2845Help
Entry
ECMDS42_2845      CDS       T02541                                 

Gene name
yrfG
Definition
(GenBank) predicted hydrolase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00230  Purine metabolism
ecok00240  Pyrimidine metabolism
ecok00760  Nicotinate and nicotinamide metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECMDS42_2845 (yrfG)
   00240 Pyrimidine metabolism
    ECMDS42_2845 (yrfG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECMDS42_2845 (yrfG)
Enzymes [BR:ecok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ECMDS42_2845 (yrfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: BAL40013
Position
2980595..2981263
Genome map
AA seq 222 aa AA seqDB search
MHINIAWQDVDTVLLDMDGTLLDLAFDNYFWQKLVPETWGAKNGVTPQEAMEYMRQQYHD
VQHTLNWYCLDYWSEQLGLDICAMTTEMGPRAVLREDTIPFLEALKASGKQRILLTNAHP
HNLAVKLEHTGLDAHLDLLLSTHTFGYPKEDQRLWHAVAEATGLKAERTLFIDDSEAILD
AAAQFGIRYCLGVTNPDSGIAEKQYQRHPSLNDYRRLIPSLM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaacattgcctggcaggacgtagataccgttctgctggatatggacggcacg
ttgctcgacctcgccttcgataactatttctggcaaaagctggtgcctgaaacatggggc
gcgaaaaacggggttacgccacaggaagcgatggaatatatgcgccagcaatatcacgac
gtacagcatacgctaaactggtactgtcttgattactggagtgagcaactgggtctggat
atctgtgcgatgaccaccgagatgggaccgcgtgccgtactgcgtgaagataccattccg
tttcttgaggcactgaaagccagcggtaagcagcgaattttgctcaccaatgcgcatccg
cacaacctggcggtaaaacttgagcataccggtctggacgcacaccttgatttattactt
tccacccacacatttggttatccgaaagaggatcagcggttatggcatgcggtggccgaa
gctacgggtctgaaagctgaaagaacgctgtttattgatgacagcgaagcgattctcgat
gctgccgcgcaatttggtattcgttactgcctcggcgtgactaatcctgattccgggatt
gccgagaaacagtatcaacgccatccgtcactgaatgactaccgccgcctgatcccctcg
ctaatgtga

DBGET integrated database retrieval system