KEGG   Escherichia coli K-12 MDS42: ECMDS42_2849Help
Entry
ECMDS42_2849      CDS       T02541                                 

Gene name
pck
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00010  Glycolysis / Gluconeogenesis
ecok00020  Citrate cycle (TCA cycle)
ecok00620  Pyruvate metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01120  Microbial metabolism in diverse environments
ecok01130  Biosynthesis of antibiotics
ecok01200  Carbon metabolism
Module
ecok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECMDS42_2849 (pck)
   00020 Citrate cycle (TCA cycle)
    ECMDS42_2849 (pck)
   00620 Pyruvate metabolism
    ECMDS42_2849 (pck)
Enzymes [BR:ecok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ECMDS42_2849 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: BAL40017
Structure
PDB: 

Position
2984744..2986366
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgaccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctacgacctgctgtatcaggaagagctcgatccgagc
ctgacaggttatgagcgcggggtgttaactaatctgggtgccgttgccgtcgataccggg
atcttcaccggtcgttcaccaaaagataagtatatcgtccgtgacgataccactcgcgat
actttctggtgggcagacaaaggcaaaggtaagaacgacaacaaacctctctctccggaa
acctggcagcatctgaaaggcctggtgaccaggcagctttccggcaaacgtctgttcgtt
gtcgacgctttctgtggtgcgaacccggatactcgtctttccgtccgtttcatcaccgaa
gtggcctggcaggcgcattttgtcaaaaacatgtttattcgcccgagcgatgaagaactg
gcaggtttcaaaccagactttatcgttatgaacggcgcgaagtgcactaacccgcagtgg
aaagaacagggtctcaactccgaaaacttcgtggcgtttaacctgaccgagcgcatgcag
ctgattggcggcacctggtacggcggcgaaatgaagaaagggatgttctcgatgatgaac
tacctgctgccgctgaaaggtatcgcttctatgcactgctccgccaacgttggtgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgtcgcctgattggcgatgacgaacacggctgggacgatgacggcgtgtttaac
ttcgaaggcggctgctacgcaaaaactatcaagctgtcgaaagaagcggaacctgaaatc
tacaacgctatccgtcgtgatgcgttgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaacacccgcgtttcttatccgatctatcac
atcgataacattgttaagccggtttccaaagcgggccacgcgactaaggttatcttcctg
actgctgatgctttcggcgtgttgccgccggtttctcgcctgactgccgatcaaacccag
tatcacttcctctctggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctccgcttgcttcggcgcggcattcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggcgcgcaggcttatctggttaac
actggctggaacggcactggcaaacgtatctcgattaaagatacccgcgccattatcgac
gccatcctcaacggttcgctggataatgcagaaaccttcactctgccgatgtttaacctg
gcgatcccaaccgaactgccgggcgtagacacgaagattctcgatccgcgtaacacctac
gcttctccggaacagtggcaggaaaaagccgaaaccctggcgaaactgtttatcgacaac
ttcgataaatacaccgacacccctgcgggtgccgcgctggtagcggctggtccgaaactg
taa

DBGET integrated database retrieval system