KEGG   Escherichia coli K-12 MDS42: ECMDS42_2851Help
Entry
ECMDS42_2851      CDS       T02541                                 

Gene name
ompR
Definition
(GenBank) DNA-binding response regulator in two-component regulatory system with EnvZ
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok02020  Two-component system
ecok02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECMDS42_2851 (ompR)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECMDS42_2851 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecok02022]
    ECMDS42_2851 (ompR)
Two-component system [BR:ecok02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ECMDS42_2851 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: BAL40019
Structure
PDB: 

Position
complement(2987791..2988510)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaagattctggtggtcgatgacgacatgcgcctgcgtgcgctgctg
gaacgttatctcaccgaacaaggcttccaggttcgaagcgtcgctaatgcagaacagatg
gatcgcctgctgactcgtgaatctttccatcttatggtactggatttaatgttacctggt
gaagatggcttgtcgatttgccgacgtcttcgtagtcagagcaacccgatgccgatcatt
atggtgacggcgaaaggggaagaagtggaccgtatcgtaggcctggagattggcgctgac
gactacattccaaaaccgtttaacccgcgtgaactgctggcccgtatccgtgcggtgctg
cgtcgtcaggcgaacgaactgccaggcgcaccgtcacaggaagaggcggtaattgctttc
ggtaagttcaaacttaacctcggtacgcgcgaaatgttccgcgaagacgagccgatgccg
ctcaccagcggtgagtttgcggtactgaaggcactggtcagccatccgcgtgagccgctc
tcccgcgataagctgatgaaccttgcccgtggtcgtgaatattccgcaatggaacgctcc
atcgacgtgcagatttcgcgtctgcgccgcatggtggaagaagatccagcgcatccgcgt
tacattcagaccgtctggggtctgggctacgtctttgtaccggacggctctaaagcatga

DBGET integrated database retrieval system