KEGG   Escherichia coli K-12 MDS42: ECMDS42_3046Help
Entry
ECMDS42_3046      CDS       T02541                                 

Gene name
gpmI
Definition
(GenBank) phosphoglycero mutase III, cofactor-independent
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00010  Glycolysis / Gluconeogenesis
ecok00260  Glycine, serine and threonine metabolism
ecok00680  Methane metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01120  Microbial metabolism in diverse environments
ecok01130  Biosynthesis of antibiotics
ecok01200  Carbon metabolism
ecok01230  Biosynthesis of amino acids
Module
ecok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecok_M00002  Glycolysis, core module involving three-carbon compounds
ecok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECMDS42_3046 (gpmI)
  09102 Energy metabolism
   00680 Methane metabolism
    ECMDS42_3046 (gpmI)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECMDS42_3046 (gpmI)
Enzymes [BR:ecok01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ECMDS42_3046 (gpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Phosphodiest Sulfatase PPR_long PIG-L PglZ Phage_TTP_12
Motif
Other DBs
NCBI-ProteinID: BAL40206
Position
3214474..3216018
Genome map
AA seq 514 aa AA seqDB search
MLVSKKPMVLVILDGYGYREEQQDNAIFSAKTPVMDALWANRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATV
IRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYAA
DIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEA
LDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKNVKA
VEGGKLSDIAPTMLSLMGMEIPQEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttggtttctaaaaaacctatggtactggtgattctggatggctatggctatcgcgaa
gaacagcaggataacgccatttttagtgctaaaaccccggtaatggatgcactgtgggcc
aatcgtccgcataccctaatcgacgcttccggtctggaagtcggtctgcctgaccgtcag
atgggtaactccgaagtaggccacgttaacctgggtgccggccgcatcgtgtatcaggac
ctgactcgtctggacgttgaaatcaaagatcgcgctttctttgctaatccggtgctgact
ggcgcggtagataaagcgaaaaacgcaggcaaagcggtacacattatgggtctgctctcc
gcaggcggcgtacacagccacgaagatcacatcatggcgatggtagaactggcagctgaa
cgcggcgcagaaaaaatctacctgcacgcattccttgacggtcgcgacactccgccgcgc
agtgctgaatcctcgctgaaaaaattcgaagaaaaatttgccgcgctgggcaaaggccgc
gtagcgtccatcattggtcgttactacgcgatggaccgcgataaccgttgggatcgcgta
gaaaaagcttatgacctgctgactctggcgcagggcgagttccaggccgataccgccgtt
gctggtttgcaggctgcttatgctcgcgacgaaaatgatgaattcgtgaaagcgaccgtt
atccgtgctgaaggtcagccagacgcggcaatggaagacggcgatgcactgattttcatg
aacttccgtgctgaccgcgcgcgtgaaatcactcgtgctttcgtgaacgctgatttcgat
ggcttcgcgcgtaagaaagtggttaacgtcgatttcgtgatgctgaccgaatacgccgct
gacatcaaaactgcggttgcttacccacccgcttccctggttaacaccttcggcgagtgg
atggcgaaaaacgacaaaactcagttgcgtatttccgaaaccgaaaaatatgcccacgtt
actttcttcttcaacggtggcgtagaagagtcgttcaaaggcgaagatcgcattctgatc
aactcaccgaaagtggctacctacgatctgcaaccggaaatgagctccgcagagctgacc
gaaaaactggttgcggccatcaagagcggcaaatacgacaccatcatctgtaactatccg
aacggcgacatggtaggtcacaccggggtgatggaagcggcggttaaagcggttgaagcg
ctggatcactgcgtggaagaagtcgcgaaagcggttgagtccgtgggtggacaactgctg
atcaccgctgaccacggtaacgctgagcagatgcgcgatccggcaacgggtcaggcacac
acggcacacaccaacctgccagttccgctgatttacgttggtgataagaacgtgaaagcg
gttgaaggcggcaaactttctgacatcgcgccgaccatgttgtcgctgatgggtatggaa
atcccgcaagagatgactggtaagccgctgttcatcgtggaataa

KEGG   Escherichia coli K-12 MDS42: ECMDS42_3752Help
Entry
ECMDS42_3752      CDS       T02541                                 

Gene name
ytjC
Definition
(GenBank) phosphoglyceromutase 2, co-factor independent
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00010  Glycolysis / Gluconeogenesis
ecok00260  Glycine, serine and threonine metabolism
ecok00680  Methane metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01120  Microbial metabolism in diverse environments
ecok01130  Biosynthesis of antibiotics
ecok01200  Carbon metabolism
ecok01230  Biosynthesis of amino acids
Module
ecok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecok_M00002  Glycolysis, core module involving three-carbon compounds
ecok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECMDS42_3752 (ytjC)
  09102 Energy metabolism
   00680 Methane metabolism
    ECMDS42_3752 (ytjC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECMDS42_3752 (ytjC)
Enzymes [BR:ecok01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ECMDS42_3752 (ytjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PTH2 Abhydrolase_9
Motif
Other DBs
NCBI-ProteinID: BAL40859
Position
3968340..3968987
Genome map
AA seq 215 aa AA seqDB search
MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGITHIISSDLGRTR
RTAEIIAQACGCDIIFDSRLRELNMGVLEKRHIDSLTEEEENWRRQLVNGTVDGRIPEGE
SMQELSDRVNAALESCRDLPQGSRPLLVSHGIALGCLVSTILGLPAWAERRLRLRNCSIS
RVDYQESLWLASGWVVETAGDISHLDAPALDELQR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggtatacctagtccgccacggtgaaacgcagtggaacgccgagcgacgtatt
cagggccagtctgacagcccgctgaccgccaaaggtgagcaacaggcgatgcaggtggca
acccgtgccaaagagcttggcattacgcatatcatcagtagcgatttaggacgcacccgg
cgtacggcggaaatcatcgcccaggcctgcggctgtgacatcatctttgattctcgcctg
cgtgaattaaacatgggtgtgctggaaaaaagacatatcgattctctgaccgaagaagaa
gagaactggcgtcggcagctggtcaatggcaccgttgacgggcgtattcctgaaggcgag
tcaatgcaggagctcagcgatcgcgtcaatgcggcactggaatcttgccgggacttaccg
cagggaagccgaccgctgctggtgagtcatggtattgcactgggatgcctggtgagtacg
attctcggattaccagcatgggcagagcgccgcttacgtctgcgtaactgttctatttcg
cgcgtggattatcaggaaagcctgtggctggcgtctggctgggtcgttgaaaccgcaggg
gacatctcgcatctggacgcccctgcattagatgagctgcagcgttaa

DBGET integrated database retrieval system