KEGG   Escherichia coli K-12 MDS42: ECMDS42_3383Help
Entry
ECMDS42_3383      CDS       T02541                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase, NAD
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00561  Glycerolipid metabolism
ecok00640  Propanoate metabolism
ecok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECMDS42_3383 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ECMDS42_3383 (gldA)
Enzymes [BR:ecok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ECMDS42_3383 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAL40515
Structure
PDB: 

Position
complement(3567145..3568248)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVE
IAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIAST
DAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALS
HAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcattattcaatcaccgggtaaatacatccagggcgctgatgtgattaatcgt
ctgggcgaatacctgaagccgctggcagaacgctggttagtggtgggtgacaaatttgtt
ttaggttttgctcaatccactgtcgagaaaagctttaaagatgctggactggtagtagaa
attgcgccgtttggcggtgaatgttcgcaaaatgagatcgaccgtctgcgtggcatcgcg
gagactgcgcagtgtggcgcaattctcggtatcggtggcggaaaaaccctcgatactgcc
aaagcactggcacatttcatgggtgttccggtagcgatcgcaccgactatcgcctctacc
gatgcaccgtgcagcgcattgtctgttatctacaccgatgagggtgagtttgaccgctat
ctgctgttgccaaataacccgaatatggtcattgtcgacaccaaaatcgtcgctggcgca
cctgcacgtctgttagcggcgggtatcggcgatgcgctggcaacctggtttgaagcgcgt
gcctgctctcgtagcggcgcgaccaccatggcgggcggcaagtgcacccaggctgcgctg
gcactggctgaactgtgctacaacaccctgctggaagaaggcgaaaaagcgatgcttgct
gccgaacagcatgtagtgactccggcgctggagcgcgtgattgaagcgaacacctatttg
agcggtgttggttttgaaagtggtggtctggctgcggcgcacgcagtgcataacggcctg
accgctatcccggacgcgcatcactattatcacggtgaaaaagtggcattcggtacgctg
acgcagctggttctggaaaatgcgccggtggaggaaatcgaaaccgtagctgcccttagc
catgcggtaggtttgccaataactctcgctcaactggatattaaagaagatgtcccggcg
aaaatgcgaattgtggcagaagcggcatgtgcagaaggtgaaaccattcacaacatgcct
ggcggcgcgacgccagatcaggtttacgccgctctgctggtagccgaccagtacggtcag
cgtttcctgcaagagtgggaataa

DBGET integrated database retrieval system