KEGG   Escherichia coli LY180: LY180_11865Help
Entry
LY180_11865       CDS       T02846                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00220  Arginine biosynthesis
ecol00250  Alanine, aspartate and glutamate metabolism
ecol00290  Valine, leucine and isoleucine biosynthesis
ecol01100  Metabolic pathways
ecol01110  Biosynthesis of secondary metabolites
ecol01130  Biosynthesis of antibiotics
ecol01210  2-Oxocarboxylic acid metabolism
ecol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecol00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LY180_11865
   00290 Valine, leucine and isoleucine biosynthesis
    LY180_11865
   00220 Arginine biosynthesis
    LY180_11865
Enzymes [BR:ecol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LY180_11865
    2.6.1.66  valine---pyruvate transaminase
     LY180_11865
Amino acid related enzymes [BR:ecol01007]
 Aminotransferase (transaminase)
  Class I
   LY180_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 16980043
NCBI-ProteinID: AGW09506
Structure
PDB: 

Position
2498872..2500089
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaacccagccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcaccagattacccactatggaccgcggcggtttcgctttccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctttacgacgacgctgagcat
cactcaattgcgccgctggcacctgacctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaactgatcaacgatatt
ccgggcgtttcctgcgtgaaacctcgtggtgcgctgtatatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system