KEGG   Escherichia coli LY180: LY180_11950Help
Entry
LY180_11950       CDS       T02846                                 

Gene name
glnQ
Definition
(GenBank) glutamine ABC transporter ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
ecol  Escherichia coli LY180
Pathway
ecol02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LY180_11950 (glnQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecol02000]
    LY180_11950 (glnQ)
Enzymes [BR:ecol01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     LY180_11950 (glnQ)
Transporters [BR:ecol02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    LY180_11950 (glnQ)
   Histidine transporter
    LY180_11950 (glnQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 PRK G-alpha AAA_33 RsgA_GTPase AAA_24 FtsK_SpoIIIE DUF87 NACHT AAA_22
Motif
Other DBs
NCBI-GeneID: 16980060
NCBI-ProteinID: AGW09521
Position
complement(2515145..2515918)
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaataaattaaacgttatcgatttgcacaaacgctacggcgaacatgaagtg
ctgaaaggggtctcactgcaagcgaatgccggagatgtaataagcatcatcggatcgtcg
ggatcggggaaaagtacctttctgcgctgcattaacttcctcgaaaaaccgagtgaaggg
tcgatcgtggtcaatggccagacgatcaatctggtgcgcgacaaagacggtcaactcaaa
gtcgccgataaaaatcaactgcgcttactgcgcacacgcctgacgatggtattccagcac
ttcaatctctggagccatatgacggtgctggaaaacgtcatggaagcgccgattcaggtg
ttgggcctgagcaagcaggaagcgcgcgagcgggcggtcaagtatctggcaaaagtcggg
atagacgaacgtgcgcaggggaaatatccggtgcatctttccggcggtcagcaacagcgt
gtttctatcgcgcgggcgctggcgatggaaccggaagttttactgtttgatgaacctacc
tcggcgctcgatcctgaactggtaggcgaagtgttgcgtattatgcagcaactggcagaa
gaggggaaaaccatggtggtagtgactcacgaaatgggctttgctcgccatgtttctact
catgtcattttcctccatcaggggaaaatagaagaagagggcgcgccggagcagttattt
ggcaacccgcaaagccctcgtctgcaacagttccttaagggatcgctgaaataa

DBGET integrated database retrieval system