KEGG   Escherichia coli LY180: LY180_11960Help
Entry
LY180_11960       CDS       T02846                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
ecol  Escherichia coli LY180
Pathway
ecol02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LY180_11960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecol02000]
    LY180_11960
Transporters [BR:ecol02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    LY180_11960
   Histidine transporter
    LY180_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DcuC
Motif
Other DBs
NCBI-GeneID: 16980062
NCBI-ProteinID: AGW09523
Position
complement(2516639..2517325)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQVFRRIMFPAMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgggttttcaggtgttattttacagggtgcgctcgtcacgctggagctggct
atcagttctgtagtgctcgctgtaatcatcggtttaattggcgctggcggtaagctctcg
caaaatcggctttcggggctgattttcgaagggtacaccacgctgattcgaggcgtgccg
gacttggtgttgatgctgctgattttctacggtttgcagattgcactaaacacggtgacg
gaggcgatgggcgtcgggcagattgatatcgatccgatggtcgctggtattattactctc
ggttttatctacggtgcttattttaccgaaacgttccgtggcgcgtttatggcagtgccg
aaagggcatatagaggcggcgacggcgttcggttttactcgtgggcaagtgtttcggcgg
atcatgtttccggcgatgatgcgttacgccctgccaggcattggcaacaactggcaggtg
atcctcaaatctaccgcactggtttcgttactcggcctggaagatgtggtcaaagccacc
caactggcaggcaaaagtacctgggaaccgttctatttcgccatcgtctgtggcgtgatt
tacctggttttcaccactgtttccaatggtgtgctgctgttccttgagcgccgctactcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system