KEGG   Escherichia coli LY180: LY180_12225Help
Entry
LY180_12225       CDS       T02846                                 

Definition
(GenBank) oxalyl-CoA decarboxylase
  KO
K01577  oxalyl-CoA decarboxylase [EC:4.1.1.8]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00630  Glyoxylate and dicarboxylate metabolism
ecol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LY180_12225
Enzymes [BR:ecol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.8  oxalyl-CoA decarboxylase
     LY180_12225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 16980115
NCBI-ProteinID: AGW09574
Structure
PDB: 

Position
complement(2576078..2576998)
Genome map
AA seq 306 aa AA seqDB search
MVTLWGNYEGISQDVVMLVGARLNWLLAHGKKGWAADTQFIQLDIEPQEIDSNRPIAVPV
VGDIASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNAQKMHEKLSTDTQPLNYFNALSA
VRDVLRENQDIYLVNEGANTLDNARNIIDMYKPRRRLDCGTWGVMGIGMGYAIGASVTSG
SPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNGGIYRGDGVDLSGAGAPSPTDLLH
HARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINVVIDPAAGTESGHITKLNP
KQVAGN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggttacgctttggggaaattatgaggggatctctcaggacgttgtcatgcttgttggt
gcacgactgaattggttattggcacacggtaaaaaaggatgggcggcagatacacagttt
attcaactggatattgaaccgcaggaaattgacagcaaccgccccattgctgtgccagtc
gttggtgatattgcatccagtatgcaaggtatgctggcagaactgaaacaaaacacattt
acgactccactggtatggcgcgatattttaaatatccacaagcagcaaaatgcacaaaaa
atgcatgaaaaattaagtacagatactcaaccattaaattactttaatgcattaagtgct
gtgcgcgacgtattgcgcgagaaccaggatatttatttagttaatgaaggtgcaaatacc
ctggataatgcacgaaatattattgatatgtataaaccacgtcgtcgtctggattgtggt
acctggggtgtcatgggcatcggtatgggctatgccatcggtgctagcgtgacttctggt
tctccggttgtcgccattgaaggtgatagtgcttttggtttcagtgggatggaaattgaa
acgatttgtcgatataacctgccggtgacgatcgttatttttaataatggcggcatctac
agaggagacggtgttgatctcagtggcgctggtgcaccatcaccaacggatctgttgcac
catgcaaggtatgacaaattaatggatgcgtttcgtggcgttggctataacgtcaccacg
acagatgaacttcgtcatgctttaaccaccggtattcagtcgcgcaaaccgaccattatt
aatgtggtcatcgaccctgcagcaggaactgaaagtggccatattaccaaacttaaccca
aaacaagtcgctggtaattaa

DBGET integrated database retrieval system