KEGG   Escherichia coli LY180: LY180_14335
Entry
LY180_14335       CDS       T02846                                 

Definition
(GenBank) OmpA family protein
Organism
ecol  Escherichia coli LY180
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-GeneID: 16980537
NCBI-ProteinID: AGW11700
Position
3010899..3012551
AA seq 550 aa
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTG
DAGLSSLPPETYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTL
RPAWASQLAVAYTVMPGMYRDAAVLTGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPL
PEKAHSPWLICTGGEIQVATSAETASPAQWLTQTSTQERSQPLCYLLKAESLMQWLNLYV
LAALNGPEAKCPPLAMAVGLHPSLPAVDNNLWQLWITARTGLTTDIADTGTDATLPFPDA
LLRRLPRQSGFTPLRRASVTMLGITTVAGIAALCLSATANHQLLRHIGDDLHQFYAVPAE
EFITKARRLSVLKDDAVMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDTLVNIRAKPGWLILVAGYTDATGDE
KSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLV
PRSDACQDVK
NT seq 1653 nt   +upstreamnt  +downstreamnt
gtgaggaacacgctgaaacaggccgtcgtgctgtggggaatggtgttactgctggtgctg
tggtcggtgtttatcagtccgtctggcgtactgagatgggccggggcggcggctatcgtt
ctggcggttgccgcgttgctgatttaccggcgcaggcaggcgtggacggagatgaccggc
gatgccgggttgtcatcgctgccgccggaaacgtaccgacaaccggtagtgctggtctgt
ggcgatatgtcggcgcatctgttcactgacagcccggtccggcaggtttcagaagggctg
tatctgcatgttcccgatgaagaacagcttgtggcgcaggtggagcgattactgaccctt
cgcccggcgtgggcatcgcagcttgccgtggcgtataccgtcatgcccggcatgtaccgg
gatgcggcggttctgaccggacgactgcgacggttcgcccacagtatggcgacagtgcgt
cgccgggcgggcgtaaacgtcccctggcttctctggagcgggctgtccggctcgcccttg
ccggagaaggcacattcaccgtggcttatctgtaccggcggcgaaattcaggtagcgacg
tctgctgaaaccgcctcccccgcgcagtggctcacgcagaccagcacacaggagcgcagc
cagccactctgttacctgctgaaagccgaaagcctgatgcagtggctgaatctttatgtg
ctggcggcactgaacggcccggaggcgaaatgcccgccactggcgatggccgtggggcta
cacccctcgttgcctgcagtggataacaacctgtggcagctgtggatcaccgccagaacc
ggcctgacgacggatatcgcggacaccggcacagacgccacgctgccgtttccggatgcc
ctgttacggcggttgccgcgtcagtcgggctttaccccgctgcgacgggccagtgtaacc
atgctgggcatcaccaccgtggcgggtatcgccgcgctgtgtctgtcagccacggcgaat
caccagttattacggcatatcggtgacgatctgcaccagttttatgccgttccggcggag
gaatttatcaccaaagcccgtcgtctgtcggtgctgaaagacgatgcggtcatgctcgat
gggtattaccgggaaggagaaccgctgcgtctcggtctggggttataccccggcgaacaa
atccgccagccggtattacgcgccattcgtgactggcgtccgcctgagcaaaaaatggaa
gtgacagcctcgcttcaggcgcagaccgtgcgtcttgacagtatgtcgctgtttgacgtc
ggacaggcccgcctgaaagacggctcgacaaaagtgctggtggacacactggtgaacatc
cgggcaaaaccgggctggcttatcctcgtggccggatataccgacgccaccggcgacgaa
aaaagcaatcagcagttatcactgcgacgtgccgaagcggtgcgtaactggatgctgcag
accagcgacatcccggccacctgttttgccgtacagggactgggtgagagccagcctgcg
gcgaccaacgatacgccacagggccgggcagtcaaccggcgcgtcgaaatcagtcttgtt
ccgcgttctgacgcctgtcaggacgtgaaataa

DBGET integrated database retrieval system