KEGG   Escherichia coli LY180: LY180_14760
Entry
LY180_14760       CDS       T02846                                 

Definition
(GenBank) xanthine dehydrogenase subunit C
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecol  Escherichia coli LY180
Pathway
ecol00230  Purine metabolism
ecol01100  Metabolic pathways
ecol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LY180_14760
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 16980622
NCBI-ProteinID: AGW09988
Position
3105918..3106397
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system