KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_2207Help
Entry
ECRM13514_2207    CDS       T03010                                 

Gene name
btuE
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00480  Glutathione metabolism
ecoo00590  Arachidonic acid metabolism
ecoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ECRM13514_2207 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECRM13514_2207 (btuE)
Enzymes [BR:ecoo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECRM13514_2207 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AHG08887
Position
complement(2169570..2170121)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVSSKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtctcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgaggttttgtggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaac
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system