KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_2308Help
Entry
ECRM13514_2308    CDS       T03010                                 

Gene name
fadD
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00061  Fatty acid biosynthesis
ecoo00071  Fatty acid degradation
ecoo01100  Metabolic pathways
ecoo01212  Fatty acid metabolism
ecoo02024  Quorum sensing
Module
ecoo_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECRM13514_2308 (fadD)
   00071 Fatty acid degradation
    ECRM13514_2308 (fadD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECRM13514_2308 (fadD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecoo01004]
    ECRM13514_2308 (fadD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoo04147]
    ECRM13514_2308 (fadD)
Enzymes [BR:ecoo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     ECRM13514_2308 (fadD)
Lipid biosynthesis proteins [BR:ecoo01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   ECRM13514_2308 (fadD)
Exosome [BR:ecoo04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   ECRM13514_2308 (fadD)
  Exosomal proteins of breast cancer cells
   ECRM13514_2308 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AHG08988
Position
complement(2266344..2268029)
Genome map
AA seq 561 aa AA seqDB search
MKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVARYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVDKTAVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNA
TYGPLLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAITGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ
RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV
QEVAAVGVPSGSSGEAVKIFVVKKDPSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSN
VGKILRRELRDEARGKVDNKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaggtttggcttaaccgttatcccgcggacgttccgacggagatcaaccctgac
cgttatcaatctctggtagatatgtttgagcagtcggtcgcgcgctacgccgatcagcct
gcgtttgtgaatatgggggaggtgatgaccttccgcaagctggaagagcgcagtcgcgcg
tttgccgcttatttgcaacaagggttggggctgaagaaaggcgatcgcgttgcgctgatg
atgcctaacttattgcaatatccagtggcgctgtttggcattttgcgcgccgggatgatt
gtcgtaaacgtcaacccgttgtataccccgcgcgagcttgagcatcagcttaacgatagt
ggcgcatcggcgattgttatcgtgtctaactttgcccacactctggaaaaggtagttgat
aaaaccgccgttcagcacgtaattctgacccgtatgggcgatcagctatctacggcaaaa
ggcacggtagtcaatttcgttgttaaatacatcaagcgtttggtgccgaaataccatctg
ccagatgccatttcatttcgtagcgcactgcataacggctaccggatgcagtacgtcaaa
cccgaactggtgccggaagatttagccttcctgcaatacaccggcggcaccacaggtgtg
gcgaaaggcgcgatgctgactcaccgcaatatgctggcgaacctggaacaggtcaacgct
acctatgggccgttgctgcatccaggtaaagaactggtagtaacggcactgccgctgtat
cacatttttgccctgaccattaactgcctgctgtttatcgaactgggtgggcagaacctg
cttatcactaacccgcgtgatattccagggttggtaaaagagttagcgaaatatccgttt
accgctatcactggcgttaacaccttgttcaatgcgttgctgaacaataaagagttccag
cagctggatttctccagtctgcatctttccgcaggcggtgggatgccagtgcagcaagtg
gtggcagagcgttgggtgaaactgacaggacagtatctgctggaaggctatggccttacc
gagtgtgcgccgctggtcagcgttaacccatatgatattgattatcatagtggtagcatc
ggtttgccggtgccgtcgacggaagccaaactggtggatgatgatgataatgaagtacca
ccgggtcaaccgggtgagctttgtgtcaaaggaccgcaggtgatgctgggttactggcag
cgtccggatgctacagatgagatcatcaaaaatggctggttacacaccggcgacatcgcg
gtgatggatgaagaagggttcctgcgcattgtcgatcgtaaaaaagacatgattctggtt
tccggttttaacgtctatcccaacgagattgaagatgtcgtcatgcagcatcctggcgta
caggaagtcgcggctgttggcgtaccttccggctccagtggtgaagcggtgaaaatcttc
gtagtgaaaaaagatccatcgcttaccgaagagtcactggtgaccttttgccgccgtcag
ctcacgggctacaaagtaccgaagctggtggagtttcgtgatgagttaccgaaatctaac
gtcggaaaaattttgcgacgagaattacgtgacgaagcgcgcggcaaagtggacaataaa
gcctga

DBGET integrated database retrieval system