KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_3197Help
Entry
ECRM13514_3197    CDS       T03010                                 

Definition
(GenBank) putative oxalyl-CoA decarboxylase
  KO
K01577  oxalyl-CoA decarboxylase [EC:4.1.1.8]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00630  Glyoxylate and dicarboxylate metabolism
ecoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECRM13514_3197
Enzymes [BR:ecoo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.8  oxalyl-CoA decarboxylase
     ECRM13514_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AHG09872
Structure
PDB: 

Position
complement(3097620..3099314)
Genome map
AA seq 564 aa AA seqDB search
MSDQLQMTDGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYA
AAASGFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEE
LDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEA
LTTIVKVENPSPALLPCPKSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIESAQI
PFLPMSMAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGKKGWAADTQFIQ
LDIEPQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNAQKMH
EKLSTDTQPLNYFNALSAVRDVLRENQDIYLVNEGANTLDNARNIIDMYKPRRRLDCGTW
GVMGIGMGYAIGASVTSGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNGGIYRG
DGVDLSGAGAPSPTDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINV
VIDPAAGTESGHITKLNPKQVAGN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcaacttcaaatgacagatggtatgcatatcatcgttgaagcattaaaacag
aataatattgacactatttatggtgttgtaggtattcctgtgacggatatggcgcgccat
gcccaggcggaaggcattcgttatattggttttcgtcatgagcagtcggcaggctatgcc
gctgcggcaagcggttttcttacccaaaaaccagggatctgcctgacagtgtctgcgcca
ggattcctcaatggtttgaccgcattggccaacgcaacggtaaatggttttccgatgatc
atgattagcggctccagcgaccgcgcgatcgtcgacctacagcaaggtgattatgaagag
ctggaccaaatgaatgcggcaaaaccgtatgccaaagcagcatttcgcgttaatcagccg
caggatcttggcattgcattggcacgcgctatccgagtctcagtatcgggtcgccctggc
ggagtttatcttgatttgccagcaaatgtcctggccgcgacgatggaaaaagacgaagcg
ttaaccacgattgtaaaagttgaaaatccgtcgccagcattattgccatgcccgaagtca
gtcactagcgcaatttcgcttttagcaaaagctgaacggccattaattatccttggcaaa
ggcgcggcgtattcacaagctgacgaacagcttcgtgaatttattgaaagtgcccagatt
ccattcctgccaatgtctatggcgaaagggatcctcgaagatacgcatccactttctgcg
gcagctgcgcgttcgtttgccctggcaaatgctgacgttgtcatgcttgttggtgcacga
ctgaattggttactggcacacggtaaaaaaggatgggcggcagatacacagtttattcaa
ctggatattgaaccgcaggaaattgacagcaaccgccccattgctgtgccagtcgttggc
gatattgcatccagtatgcaaggtatgctggcagaactgaaacaaaacacatttacgact
ccactggtatggcgcgatattttaaatattcacaagcagcaaaatgcacaaaaaatgcat
gaaaaattaagtacagatacccaaccattaaattactttaatgcattaagtgctgtgcgc
gatgtattgcgtgagaaccaggatatttatttagttaatgaaggtgcaaataccctggat
aatgcacgaaatattattgatatgtataaaccacgtcgtcgtctggattgtggtacctgg
ggtgtcatgggcatcggtatggggtatgccatcggtgctagcgtgacctctggttctccg
gttgtcgccattgaaggtgatagtgcttttggtttcagtgggatggaaattgaaacgatt
tgtcgatataacctgccggtgacgatcgttatttttaataatggcggcatctacagagga
gacggtgttgatctcagtggcgctggtgcaccatcaccaacagatctgttgcaccatgca
aggtatgacaaattaatggatgcgtttcgtggtgttggctataacgtcaccacgacagat
gaacttcgtcatgctttaaccaccggtattcagtcgcgcaaaccgaccattattaatgtg
gtcatcgaccctgcagcaggaactgaaagtggccatattaccaaacttaacccaaaacaa
gtcgctggtaattaa

DBGET integrated database retrieval system