KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_4949Help
Entry
ECRM13514_4949    CDS       T03010                                 

Gene name
yihX
Definition
(GenBank) putative haloacid dehalogenase-like hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00010  Glycolysis / Gluconeogenesis
ecoo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECRM13514_4949 (yihX)
Enzymes [BR:ecoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ECRM13514_4949 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: AHG11584
Structure
PDB: 

Position
4837507..4838106
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGTWSDLTRIPLATLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggaacctggagcgatttaacgcgtattccgctggctacgcttaagaagagttttcatatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggccctgccgctaagctatgagcagttctcccacggttggcaggcg
gtatttgttgcgctacgaccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggttgtgctttccaatactaaccgcctgcatactaccttctggccggaggaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagctcgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagctaatcagctgggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system