KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_5492Help
Entry
ECRM13514_5492    CDS       T03010                                 

Definition
(GenBank) Putative sugar ABC transport system, ATP-binding protein YtfR
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECRM13514_5492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecoo02000]
    ECRM13514_5492
Enzymes [BR:ecoo01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     ECRM13514_5492
Transporters [BR:ecoo02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    ECRM13514_5492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_23 AAA_30 RsgA_GTPase ABC_ATPase AAA_22 MMR_HSR1 DUF2813 AAA_15 TsaE DUF815 DLIC AAA_27
Motif
Other DBs
NCBI-ProteinID: AHG12108
Position
5359391..5360893
Genome map
AA seq 500 aa AA seqDB search
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFGLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETRELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKQQTLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaccaacaccaggaaatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgtggcgaaatcatggcgctg
ctcggtgaaaacggggcgggaaaatcgacgctaatcaaagcattaaccggtgtttaccac
gccgatcgcggcaccatctggctggaaggccaggctatctcaccgaaaaataccgcccat
gcacaacaactcggcatcggaaccgtttatcaggaagtcaacctgctacccaatatgtcg
gtcgctgataatctattcataggtcgcgaacccaaacgtttcgggcttctacgccgtaaa
gagatggaaaagcgcgccaccgaactgatggcatcttacggtttctccctcgacgtgcgt
gaaccgcttaaccgcttttcagtcgcgatgcagcaaatcgtcgccatttgccgggctatc
gatctctctgccaaagtgctgatcctcgatgaacccaccgccagtctcgacacccaggaa
gtggagttactgtttggcctgatgcgtcagttgcgcgatcgcggcgtcagcctgatcttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgcgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagttggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgcagcgttcaaaaattacggcaaaaaaggaacgatcgcaccgtttgat
ctcgaagtacgccccggcgagatcgtcggtctggctggcttgctgggatcaggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcactgcgttgatcaaa
ggcaaacagcaaaccctgcgatcgccacatcaggcttcggtactgggcatcggcttctgc
ccggaagacaggaaaaccgatggcatcatcgccgccgcctcggtgcgggaaaatatcatc
ctcgctctccaggcccagcgcggctggctacgacccatttcccgcaaagagcagcaagag
attgccgaacgctttatccgccagcttggcattcgcactccttcaactgaacaaccgatt
gaatttctctccggcggcaatcagcaaaaagtgttgctttcacgttggctactgacccga
ccgcaatttctgatccttgatgagccaacccgcggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctatgcgccgatggtctggcgctgctggtgatctcctcc
gaactggaagagctggtgggctatgccgatcgggtgatcatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system