KEGG   Eikenella corrodens: SAMEA4412678_1404Help
Entry
SAMEA4412678_1404 CDS       T05039                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ecor  Eikenella corrodens
Pathway
ecor00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ecor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAMEA4412678_1404 (gutB_1)
Enzymes [BR:ecor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SAMEA4412678_1404 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SAMEA4412678_1404 (gutB_1)
    1.1.1.-  
     SAMEA4412678_1404 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: SNW09448
Position
1:complement(1422169..1423215)
Genome map
AA seq 348 aa AA seqDB search
MSTMKAARWYGRRDIRVEDVAVPEITRPSQVKIAVKYTGICGSDLHEYLGGPIFIPVEKE
HPYSGRKAPLTLGHEFAGEIVEVGAGVTNVKVGDRVTVEPILAKDGLKGKYNLDKNLGFV
GLAADGGFTSYCVVDGELCHKLPDSIDYEQGALTEPAAVALYAVRQSKLKAGDTAAVFGC
GPIGLLTIEALRAAGATTIYAIELSPERQEKARELGAVVIDPSKVNVVEHIKAETDGGVN
VSFEVTGVAPVLKQAIEAVENDGECVIVSIWENEASIHPNEIVIKEKTVKGIIAYRDIFP
AVLQLMEQGYFPKDKLVTKRIKLQDIVSEGFEALVKEKSQVKILVSPN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaatgaaagctgcaagatggtacggccgccgcgacatccgcgtggaagacgta
gccgttcccgaaatcacacgcccgtcacaagtgaaaatcgctgtgaaatacaccggcatc
tgcggcagcgacctgcacgaatacctcggcggccctatctttatcccggtagagaaagag
catccctattccggccgcaaagccccgctcacgctcggccacgaatttgccggtgaaatt
gtggaagtgggcgctggcgtgaccaacgtgaaagtgggcgaccgcgtaaccgttgagccg
attttggccaaagacggcctcaaaggcaaatacaacctcgacaaaaacctaggcttcgtc
ggcctggctgccgacggcggcttcaccagctactgcgtggtagacggcgaattgtgccac
aaattgcccgacagcatcgactacgaacaaggcgcgctcaccgaacctgccgccgtggcc
ctgtatgccgtgcgccagagcaaactgaaagccggcgacaccgctgccgtattcggctgc
ggccccatcggcctgctcaccatcgaagccctgcgcgctgccggtgccaccaccatctac
gccatcgagctttctcctgagcgtcaggaaaaagcccgcgagctgggcgccgtagtgatc
gacccctccaaagtaaacgtagtagaacacatcaaagccgaaaccgacggtggtgtgaac
gtatcgtttgaagtaaccggcgtggctcccgtgttgaaacaagccatcgaagccgtggaa
aacgacggcgaatgcgtgatcgtgagcatttgggaaaatgaagcctccatccacccgaac
gaaatcgtgatcaaggaaaaaaccgtgaaaggcatcatcgcctaccgcgatattttcccc
gccgtgctgcaactgatggaacaaggctacttcccgaaagacaagctggttaccaaacgc
atcaagctgcaagacatcgtgagcgaaggctttgaagccttggtgaaagagaagagccaa
gtgaagattttggtgtctccgaactaa

DBGET integrated database retrieval system