KEGG   Eikenella corrodens: SAMEA4412678_1611Help
Entry
SAMEA4412678_1611 CDS       T05039                                 

Gene name
ribBA
Definition
(GenBank) Riboflavin biosynthesis protein ribBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ecor  Eikenella corrodens
Pathway
ecor00740  Riboflavin metabolism
ecor00790  Folate biosynthesis
ecor01100  Metabolic pathways
ecor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAMEA4412678_1611 (ribBA)
   00790 Folate biosynthesis
    SAMEA4412678_1611 (ribBA)
Enzymes [BR:ecor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAMEA4412678_1611 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SAMEA4412678_1611 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: SNW09752
Position
1:complement(1630710..1632068)
Genome map
AA seq 452 aa AA seqDB search
MPSPINITELRRRNLREWINRLHQGRQIDFVSATGINQGELSALLKNKPFGERKARKIEH
SAGMPALWLDTDHSSPASAPQPTHRNTRPMSTPISTIPEILADLKAGKMVIITDAEDREN
EGDLLMAAQFVTPEAINFMIKHARGLVCLPMAEELVDKLKLPLMTQHNGAQYGTNFTVSI
EAAHGISTGISAADRALTIQTAVSPAARPEDIVQPGHIFPLRAQKGGVLVRAGHTEAGVD
LAQMCGLIPAAVICEIINDDGTMARMPELTEFARQHGLKIGTITDLIEYRSRTETLLEEM
GSSPIHTPWGDFRQHVYVDKLSGETHLALVKGSPQPDTETLVRVHEPFSAMDFLQTNPRH
SWPLPRALERIQAAEHGVAILLHRTEDGAALLDRTLPKGKSQTRQWDSKTYGIGAQILAN
LHVKKMRVLGQPSSLTGLTGFGLEVTGFESME
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccccatcaatattaccgaactgcgccgccgcaacctgcgcgaatggattaac
cgcctgcaccaaggccggcagattgatttcgtctctgccaccggcatcaaccagggcgaa
ctctccgccctgttgaaaaacaagcctttcggcgagcgcaaagcccgcaaaatcgaacac
agcgccggcatgcccgcgctgtggctcgacaccgaccacagttcacccgcatccgccccg
caacccacccacaggaatacccgtcccatgtccacccccatttccaccatccccgaaatc
ctggccgacctcaaagctggtaaaatggtcatcatcaccgatgccgaagaccgcgaaaac
gaaggcgacctgctcatggccgcccaattcgttacccccgaagccatcaacttcatgatc
aaacacgcccgcggcctcgtgtgcctacccatggccgaagagctggtggacaaactcaaa
ctccccctcatgacccaacacaacggcgcgcaatacggcaccaacttcaccgtatccatc
gaagccgcccacggcatttccaccggaatttccgccgccgaccgcgcgctgaccatccaa
accgccgtttcccccgccgcccggccggaagacatcgtccagcccggccacatcttcccc
ctgcgcgcccaaaaaggcggcgtattggtgcgcgccggccacaccgaagccggcgtcgat
ttagcccaaatgtgcggcctcatccccgccgccgttatctgcgaaatcatcaatgacgac
ggcaccatggcgcgcatgcccgaactcaccgaattcgcccggcagcacggcctcaaaatc
ggcaccatcaccgacctcatcgaataccgcagccgcaccgaaaccctgcttgaagaaatg
ggcagcagccccatccatacaccctggggcgacttccgccagcacgtttatgtagacaaa
ctctccggcgaaacccacctcgccttagtgaaaggcagcccgcagcccgacaccgaaacc
ctcgtgcgcgtacacgagcccttcagcgccatggatttcctgcaaaccaacccccgccac
tcctggccgctgccgcgagccctcgagcgcatccaagccgccgaacacggcgtagccatc
ctgctgcaccgcaccgaagacggcgccgccctactcgaccgcaccctgcccaaaggcaaa
agccaaacccgccagtgggacagcaaaacctacggcatcggcgcgcaaatcctcgccaac
ctccacgtgaaaaaaatgcgcgtactcggccagccctcctccctcaccggcctcaccggc
ttcgggctggaagtaacagggtttgagagcatggaataa

DBGET integrated database retrieval system