KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_2828Help
Entry
EC958_2828        CDS       T04373                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00230  Purine metabolism
ecos00240  Pyrimidine metabolism
ecos01100  Metabolic pathways
ecos01110  Biosynthesis of secondary metabolites
Module
ecos_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ecos_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ecos_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ecos_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC958_2828
   00240 Pyrimidine metabolism
    EC958_2828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecos04131]
    EC958_2828
Enzymes [BR:ecos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     EC958_2828
Membrane trafficking [BR:ecos04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    EC958_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CDN83165
UniProt: W9AIJ0
Structure
PDB: 

Position
complement(2821963..2822394)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SVESAAREIAYFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccatcatcaaaccgaacgcagtagcaaaaaacgtgatt
ggtagtatctttgcgcgctttgaagctgcagggttcaaaattgtcggcaccaaaatgctg
cacctgaccgttgaacaggctcgtggcttttatgctgaacacgatggaaaaccgttcttt
gatggtctggttgaattcatgacttctggcccgatcgttgtttccgtgctggaaggtgaa
aatgctgttcagcgtcaccgcgatctgctgggcgcgaccaatccggcaaacgcactggcc
ggtactctgcgtgctgattacgctgacagcctgaccgaaaatggtacccacggttctgat
tccgtcgaatctgccgctcgcgaaatcgcttatttcttcggcgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system