KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_3147
Entry
EC958_3147        CDS       T04373                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00230  Purine metabolism
ecos01100  Metabolic pathways
ecos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC958_3147
Enzymes [BR:ecos01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     EC958_3147
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CDN83486
UniProt: W8ZW95
Position
3172092..3174389
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAVQLVSIEWQELPVITSSEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFIGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
aggagtttgccgggcgtcctggcgatttttacctgggaagatgtgccagaaatcccattc
gccacggcagggcatgcctggacacttgacgaaaacaagcgcgatactgccgatcgtgcc
ctgctaacgcgtcatgttcgtcatcatggtgacgccgttgccatcgtcgtagcccgcgat
gaactcacggcagaaaaagcggtgcaattggtcagcattgagtggcaagaattacccgtt
atcacctcgtcagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacgcccgttattcaacattgtcatatggaaagcgtg
acatcgctggcatggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttatcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgacaagcaaacttggcggcattccggtgaaagtttctcttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccattgcttctgctggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgat
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggaaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagagtgccagaaccagcaa
ggcaatttacgtcgtggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgcctgttgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggccagggtgccgacaccgtgttctcgcaaatggtggca
gaaaccgtgggagttccggtcagcgatgtccgcgtaatttcgacacaagacaccgacgtt
acaccattcgaccccggcgcatttgcctcacgtcagagctatgttgccgcgcctgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgccgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcactgtgtaaagtaaccatcaaccgcatcctc
aacgttcatgattcgggccatattcttaatccgctgctggcagaaggtcaggtacacggc
ggaatggggatgggcattggctgggcgctatttgaagagatgatcatcgatgcgaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccacccataattcctgtagccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctaacgccaaaacgattatatgaagaattccat
ctggcaggattgatttga

DBGET integrated database retrieval system