KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_3149
Entry
EC958_3149        CDS       T04373                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00230  Purine metabolism
ecos01100  Metabolic pathways
ecos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC958_3149
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CDN83488
UniProt: W8ZN11
Position
3175275..3175754
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacaaagtaa

DBGET integrated database retrieval system