KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_4144Help
Entry
EC958_4144        CDS       T04373                                 

Gene name
uhpB
Definition
(GenBank) sensor protein UhpB
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC958_4144 (uhpB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecos01001]
    EC958_4144 (uhpB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecos02022]
    EC958_4144 (uhpB)
Enzymes [BR:ecos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EC958_4144 (uhpB)
Protein kinases [BR:ecos01001]
 Histidine kinases
  NarL family
   EC958_4144 (uhpB)
Two-component system [BR:ecos02022]
 NarL family
  UhpB-UhpA (hexose phosphates uptake)
   EC958_4144 (uhpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 MASE1 HATPase_c HATPase_c_2 GIT_CC
Motif
Other DBs
NCBI-ProteinID: CDN84504
UniProt: W8ZQZ4
Position
complement(4210329..4211831)
Genome map
AA seq 500 aa AA seqDB search
MKTLFSRLITVIACFFIFSAAWFCLWSISLHLVERPDMAVLLFPFGLRLGLMLQCPRGYW
PVLLGAEWLLIYWLMQAVGLTHFSLLMIGSLLTLLPVALISRYRHQRDWRTLLLQGAALT
AAALLQSLPWLWHGKESWNALLLTLTGGLTLAPICLVFWHYLANNTWLPLGPSLVSQPIN
WRGRHLVWYLLLFVISLWLQLGLPDELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI
ALIASQTWRDHPVDLLLSLLVQSLTGLLLGAGIQRLRELNQSLQKELARNQHLAERLLET
EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNASVKQSGQLIEQLSLGVYDAVRR
LLGRLRPRQLDDLTLEQAIRSLMREMELEGRGIVSHLEWRIDESALSENQRVTLFRVCQE
GLNNIVKHADASAVTLQGWQHDERLMLVIEDDGSGLPPDSGQHGFGLTGMRERVTALGGT
LTISCLHGTRVSVSLPQRYV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttgttctcccgtttaattaccgttattgcctgcttttttatcttctctgcc
gcatggttttgcctgtggagtatcagcctgcacctggttgagcgccctgatatggcggtg
ctgttatttccgtttggcctgcggctagggctaatgctgcaatgcccgcgcggatactgg
ccggtgctactgggtgcggagtggctgctgatttactggctaatgcaggcggtcggttta
acccatttctccttattgatgatcggtagtttactgacgttattgcccgtggcgctgatc
tcgcgctatcgccatcaacgtgactggcgcaccttgctgttacagggtgcggcgttaacg
gcggcagcgttgttgcagtcgttgccctggctttggcacggcaaagagtcgtggaatgcg
ctgctgctgactttaactggcggcctgacgctggccccgatatgtctggtgttctggcac
tatctcgccaataacacctggctgccgctcggcccgtcactggtttctcagccaatcaac
tggcgcgggcgacatctggtctggtacttgctgctgtttgttatcagtctctggctccag
ttgggattgccagacgaactgtcgcgctttacgccattctgtctggcgctgccgattatc
gcgctggcctggcactatggttggcaaggagcgctgattgcgacattgatgaacgccatc
gcgctgatcgccagtcaaacctggcgcgatcatccggtggatttattgctctcgctgctg
gtgcaaagtctgacagggttgttactgggcgctggcatccagcggttgcgtgaacttaac
cagtcgctgcaaaaggaactggcgcgcaatcagcatctcgctgaacggttgctggaaacc
gaagagagcgtgcgccgcgatgtggcgcgagagctgcacgatgatatcggtcagaccatc
actgctattcgtactcaggctggcattgtccagcggctcgcggcggataacgccagcgtg
aaacagagcgggcagctcatcgaacagttgtcgttgggcgtttacgacgcggtgcgccgc
ttgttagggcggttacgtccgcgccagctggatgatctcaccctggagcaggccatccgc
tcactgatgcgggaaatggagctggaagggcgcggcattgtcagtcatctcgaatggcga
atcgatgaatcagcgttaagcgaaaaccagcgcgtgacgctatttcgcgtctgccaggaa
gggttgaacaacattgtgaaacatgccgatgccagcgcggtcacgctgcaaggctggcag
catgatgagcggttaatgctggtgattgaagacgatggcagcggtttaccgccagattcc
gggcaacacggttttggccttaccggaatgcgcgagcgcgtaacggcgctgggtggcaca
ttgaccatctcctgcctgcacggcacgcgtgtcagcgtttctctacctcaacgttatgtc
taa

DBGET integrated database retrieval system