KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_4449Help
Entry
EC958_4449        CDS       T04373                                 

Definition
(GenBank) putative hippuricase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00360  Phenylalanine metabolism
ecos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EC958_4449
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecos01002]
    EC958_4449
Enzymes [BR:ecos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     EC958_4449
Peptidases and inhibitors [BR:ecos01002]
 Metallo peptidases
  Family M20
   EC958_4449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DAO
Motif
Other DBs
NCBI-ProteinID: CDN84808
UniProt: W8ZZE5
Position
4535578..4536744
Genome map
AA seq 388 aa AA seqDB search
MIEHYIRGFEEELREIRHQIHENPELGLQEFKTSALVAEKLRQWGYEVEQGLATTGVVAT
LKVGDGEKSIGLRADMDALPIYENSGKPWASKHPGLMHACGHDGHTTILLGAARYFAETR
RFNGTLRLIFQPAEEMINGGEIMVKEGLFDRFPCDVIFGMHNMPGLPVGKFFFQPGALMA
SMDQFHITVRGCGGHGAIPHKAIDPVLVAAHITTALQSIVSRNVDPLEAAVITVGSIVAG
EAANVIPDSAEMKISVRSLSRDTRQLLLTRIPALAQTQAASFGATAEVTHVNGTPVLVND
EEMARFAWQVACKTFGEDRAEFGIKPLMGSEDFSFMLEAQPKGGFLLFGNGDVGEGSCMV
HNPGYDFNDASLVPASSYWGALVEAWLQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacactatattcgtgggtttgaggaagaacttcgcgagatccgccatcagatc
cacgaaaacccggagctgggattacaagaatttaaaaccagtgctttggttgcggaaaag
ctgcgccagtggggctatgaggttgagcaagggctggcgacaaccggcgtggtagccacg
ttaaaagtgggcgacggagagaaaagtattggcctgcgggcggatatggatgcgttgccg
atttatgaaaatagtggcaagccctgggccagtaaacatcctggtttaatgcacgcctgc
gggcatgacgggcataccaccatactgctgggggccgcgcgttattttgccgaaacccgc
cgttttaacggcacgttacgccttatcttccagccagcggaagagatgattaacggcggt
gagatcatggttaaagaggggctttttgatcgtttcccctgcgatgtcattttcgggatg
cacaacatgccgggtttgccggtcggcaagtttttcttccagcctggggcgctgatggcg
tcaatggatcagttccatattacggttcgtggttgtggcggacacggtgcgatcccgcac
aaagccatcgatccagtgctggttgccgcacatatcaccaccgcattacaaagcattgtg
tcgcgcaatgtcgatccgctggaagcggcggtaattaccgtcggcagcattgttgcgggt
gaggcggctaacgtcattcctgacagtgctgagatgaaaatcagtgtccgctctcttagc
cgcgatacccgacaacttcttctgacccgtattcctgctcttgcacaaacccaggctgcc
agctttggcgctacggctgaggttacgcatgttaacggtacaccggtattagtaaatgac
gaggagatggcgcgcttcgcctggcaggtggcgtgcaaaacatttggtgaagatcgggct
gagtttggcatcaaacccctgatgggcagtgaagatttctctttcatgctggaggcccaa
cccaaaggcggtttcctgttattcggtaatggcgatgtcggggaaggttcctgcatggtg
cataaccccggttacgactttaacgatgcaagcctggtcccggcaagcagctactggggc
gcactggttgaagcctggctgcaataa

DBGET integrated database retrieval system