KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0046Help
Entry
ECP_0046          CDS       T00373                                 

Definition
(GenBank) putative NAD(P)H oxidoreductase YabF
  KO
K11746  glutathione-regulated potassium-efflux system ancillary protein KefF
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecp02000]
    ECP_0046
Transporters [BR:ecp02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECP_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-ProteinID: ABG68088
UniProt: Q0TLU3
Position
48791..49321
Genome map
AA seq 176 aa AA seqDB search
MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNIDIAAEQEALSRADLIV
WQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAVTTGGGESHFEIGTHPG
FDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHYKQRLLEWQEAHHG
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgattcttataatttatgcgcatccatatccgcatcattcccatgcgaataaacggatg
cttgaacaggcaaggacgctggaaggcgtcgaaattcgctctctttatcaactctatcct
gacttcaatatcgacattgccgccgaacaggaggcgctgtctcgtgccgatctgatcgtc
tggcagcacccgatgcagtggtacagcattcctccgctcctcaaactttggatcgataaa
gtcttctcgcacggctgggcttacggtcacggcggcacggcgctgcatggcaaacattta
ctgtgggcggtgacgaccggcggtggggaaagccattttgagattggcacgcatccgggg
tttgatgtgctgtcgcagccgctacaggcgacggcaatctactgcgggctgaactggctg
ccaccgtttgccatgcactgcacctttatttgtgacgacgaaaccctcgaagggcaggcg
cgtcactataagcaacgtctgctggaatggcaggaggcacatcatggatag

DBGET integrated database retrieval system