KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0225
Entry
ECP_0225          CDS       T00373                                 

Definition
(GenBank) hypothetical membrane protein
  KO
K11911  type VI secretion system protein VasL
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_0225
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_0225
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: ABG68262
UniProt: A0A454A191
Position
complement(243248..244606)
AA seq 452 aa
MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDL
HTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNIL
RQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNR
TDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFV
AGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPP
LQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFAD
LMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgagcaataacgcactgacacaaactatcgttaccggcagcgatccgcgcgccctgccg
gagttcagcgccatccgcgaagaaattaacaaagctaaccacccgtcacagccggagctg
aactggaaactggtggaatcgctggcgctgtcgatttttaaggccaacggggtggatttg
cataccgccacctactatacgctggcacgtacacgtaatcagggactggcagggttctgt
gaaggcgcggaactgctggctgcgatgatcatccacgaatgggataaattctggccgcag
agtggcccggcgcggactgagatgctggactggttcaacacccgcaccgggaatatcctg
cgccagcaggtttccttttccgaaaatgatctttcgttgctctaccgcacggaacgggct
ttgcagcttatctgcgacaaactccagcaagtggaactgaagcgccagccgcgcgtggaa
aatctgctttattttgtgcagaacacacgcaagcggtttgagccgcagcccagaaaccgt
actgatacggcggcacagaccatggtcagaacgctggtctatgcgcctgaaggcacggct
tccgccacagcggaaaccatgccccccctacccgacctgccggaaatgcgggtgggggtg
cgcggtgtggcagataacgccgacaaagcaaaacagggcgacacggtaaaaggttttgtt
gccggtgccgcctgtactgccgttatcgcatctgcactctggtggtggcaggcgtatccg
atgcagcagcagcttacacaggtcagggataccacacagggagccgccaccgtctggttg
gcctccccggtactgaaagaatatgaacagtacctgcaacagcttctgaatgccccgcca
ctacagccgctggaaaccggaatgcagatgatgcgcaccgcagacaccctctggccggaa
agcctgcaacagcaggaagccagcaggatgtggagcaacacgctgagaaaccgggcgcaa
gccagtccgcagatgaagggctggcaacaagcgcggcagaatttgcgggattttgcagat
ttgatgatgaagaaggagacggagaaacaaggtttcaccctatcgtatatcaaaacggtg
acctggcaggccgaacggttactgaatcaagaaacaccactggagtacctgctgacgcag
taccaggagacccgtacacagaagcaggacacacaggcgttggaaaaagagatcaacgaa
cggctggacgggctgttaagccgctggctgctgctgaaaaataccggacaggatatggca
acggataacagaaccgaacctgtccatccaactcattga

DBGET integrated database retrieval system