KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0226Help
Entry
ECP_0226          CDS       T00373                                 

Definition
(GenBank) IcmF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECP_0226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_0226
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C AAA_16 AAA_29 AAA_22 DUF4131
Motif
Other DBs
NCBI-ProteinID: ABG68263
UniProt: A0A454A196
Position
complement(244617..248144)
Genome map
AA seq 1175 aa AA seqDB search
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAP
LANRWLATAVWGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWL
LRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTLLREGFPSDIVYTPESIRGVEYHPLITPR
VGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQPLNGLILTLDLPDLLTAD
KSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDRDAILGVT
FTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIV
TALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTP
YFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQS
GVNVLAQAKAFMDVPLPQGTDEFGNLQLPLLNPVRDATLAYGDYRDHGFLADMGLYQGAR
VGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPESEEKLAVLRVVRMMEDKSGRNNEAV
KQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSDSDAVSRWTPYNKPVINA
QHELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFDNVFVAGNDEKLVIPQFLTRY
GLQSYFIKQHDGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYLSDYTATWRAGM
DNLNVRDYETMPALTDALEQIISGDQPFLRALTALRDNTHALTLSGKLDDKAKEAAINEM
DYRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVSGKSALKAV
QLRLDQNSSDPIFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKP
FNEQLADNYPFNPHATQDASLDSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRMLI
REDIRQQLDTAQKIRNIFFSQQNGLGAQFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNY
TAHLVWPNNMREGNESQLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRF
NVDGGAMVYRVHVDTEDNPFTGGLFSQFRLPDTLY
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaatttcccacatcccgactgttcagcacgttgaaatctgcgctcaggccagcg
atgccgcggtttaaagtttctgccacctggctactgacgctggcatggatttttctgctg
gtgtggatctggtggcagggtccaaaatggacgctctatgagcagcactggttggctccg
ctggcaaaccgctggctggcgaccgccgtctggggacttatcgctctggtctggctcacc
tggcgggtgatgaagcgtctgcaaaagctggaaaaacagcagaaacagcagcgggaggaa
gaaaaagatccgttgaccgtggaactccaccgccagcagcaatatctggatcactggctg
ctgcgcctgcgccgccatctggataaccgccgttatctgtggcagttgccgtggtatatg
gtcattggtcctgcgggtagcggcaaaagcacgctgctgcgcgagggctttccgtctgac
attgtttacacgccggaaagcatccggggtgtggaataccacccgctgatcacaccgcga
gtgggcaaccaggcggtaattttcgatgttgacggcgtactgaccactcccggcggggat
gatctgctccgccgccgcctgcgcgaacactggctgggctggctgatgcaaacgcgcgct
cgccagccgctcaacggtcttatcctgacgctcgatcttcccgatctgctgacggcggat
aaatcccgccgtgagacactggtacaaaatttgcgccagcaacttcaggagatccgtcag
agcctgcactgccgtctgcccgtttacgtggtgctgacacggctggatctgctgaacggc
tttgccgcgctgttccattcactggataaaaaagaccgcgatgcgatcctcggcgtcaca
tttacccgccgcgcccatgaaagtgacggctggcgcagcgaactgggggctttctggcag
acgtgggtacaacaggtgaacctggcgctgtcggatctggtgctcgcacaaaccggtgct
gctccccgcagcgctgtgttcagcttctcccgtcagatgcagggaacaggagaaatcgtc
accgcactgctcgccgcattgctggacggtgagaacatggatgtaatgctgcgtggcgtc
tggctcacatcctcgctacagcgtggccaggtggatgatattttcacgcagtccgccgcc
cgccagtacggactgggtaacagctcgctggcaacctggcctctggtggagacgacgccg
tattttactcgccgcctcttcccggaagtcctgctggctgagccgaacctggcgggtgaa
aacagcgtctggctgaacagctcccggcgcaggctgaccgccttttccacctgtggcgcg
gcactggcggcattgatggtcggaagctggcaccattattacaatcagaactggcagtct
ggcgttaacgtactggcacaagctaaagcctttatggacgtaccactaccgcagggaacg
gatgaattcggcaatctgcaattgccattgcttaacccggtacgcgatgccaccctggcc
tatggtgattatcgcgatcacggttttctggcggatatgggattgtaccagggcgcccgc
gtagggccgtatgtggagcaaacctacattcagcttcttgagcagcgttatctcccctcg
ttaatgaacggcctgatccgggatctaaacattgccccgccagagagcgaagaaaagctc
gctgtgctgcgcgtagtgcgcatgatggaagacaaaagtgggcgcaacaacgaggcggta
aaacagtacatggcgcggcgctggagcaatgaatttcacggccagcgcgatattcaggcg
caactgatggtgcatctggactatgcgctggagcacaccgactggcacgcgcagcgccaa
agcagcgacagcgatgctgtaagccgctggaccccctataataaaccggtcattaatgcg
caacatgaactgagcaagctacccatataccagcgtgtctaccagacccttcgcaccaaa
gcattaagcgtgttacccgccgatttgaatttgcgcgaccaggttggtcccaccttcgac
aacgtgttcgtcgccggtaatgatgaaaaactggtgatcccgcagtttctcacccgctat
ggcctgcaaagctattttatcaaacaacacgacggtctcgttgagttgaccgcgctggat
tcgtgggtgctgaacctgacgcaaagcgtcgcctacagcgaggccgaccgtgaagagatc
cagcgccatatcactgaacagtacctcagtgactataccgctacatggcgtgccggaatg
gataatctcaacgtccgtgactatgagaccatgccggcgctgaccgacgcgctggagcag
attatcagcggtgatcagccattcctgcgtgctctgacggcgctgcgcgataatacacac
gcgctgacgctctccggcaaactggacgataaggcgaaggaagcggcgataaatgagatg
gattaccgcctgttatcccggctggggcatgagttcgcgccggaaaatagcgcactggag
gagcaaaaggacaaggcgagtactctacaggccgtgtatcagcaactgaccgagctgcac
cgttacctgctggcgatccagaactcgccagtgtctgggaaatcggcgctgaaagcagta
cagctacggctggatcaaaacagcagcgatccaatcttcgccacccgtcagatggcaaaa
accctgcctgcgcctcttaaccgctgggtaggtaagctggcggatcaggcctggcatgta
gtgatggtggaagccgttcgttacatggaagtggactggcgcgacaatgtagtgaaaccc
ttcaacgagcagcttgccgataactatccgtttaatccgcacgccacacaggatgcctca
ctggattcgtttgaacgtttctttaaaccggatggcattctggacaatttctacaagaac
aacctgcgcctgttccttgaaaacgatctgacctttggcgacgacggcagaatgttaatc
cgtgaagatatccggcagcaactggatactgcgcagaaaatccgcaacatcttcttcagc
cagcagaacgggctgggcgcacagtttgccgtggaaaccgtatcgctttccggcaataag
cggcgcagcgtacttaacctggacggccagttagtggactacagccagggacgcaactac
accgcccatctggtctggccgaacaacatgcgtgaaggcaatgaaagccagctgacgctg
attggcaccagcggcagagcaccgcgcagtatcgcgttcagcggaccgtgggcgcagttc
cgcctgttcggcgcgggccagttgaccaatgtgaccagtgacacctttaacgtgcgcttt
aacgtggacggcggcgcgatggtttaccgggtgcatgtggataccgaagataacccgttc
accggcggtctgttcagccagttccgtttaccggatacgttgtattaa

DBGET integrated database retrieval system