KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0227
Entry
ECP_0227          CDS       T00373                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_0227
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_0227
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Other DBs
NCBI-ProteinID: ABG68264
UniProt: A0A454A160
Position
complement(248164..249672)
AA seq 502 aa
MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFV
DSEIVKLGSLAHSQLDIPELQRRGLMLLASETKDFRLLAHLLRTLQHAGDILLASRMLAQ
YTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATIQRDALLGELAKLAQCWQA
HNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPHTVAAQPPV
AATPIPQVTVESHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESD
GRTPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQV
ADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAA
KACFDEYGLEAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLH
MMLSEWEPSLLKALEQKLTAEQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
ttgacgggctggcacgggttattgcgccgctacgcgacgcctgccactgggcgggagaat
aagaatatggcaatggacttacgtaatcccgatgtatggcttgcacacctgctggaaaac
ctgccagaagataagctgtccgccgcgcttgatgatggcaatgcagactgggagtttgtc
gacagcgaaatcgtcaagctcggttcactggcgcacagccagcttgatatcccggaactt
cagcgccggggcctgatgcttctggcctcagaaaccaaagattttcgcctgctggcccac
ttgctgcgtaccctgcaacatgccggtgatattctgctggcctccaggatgctggcacaa
tatacagagcactactggacatgcgccgcaccgcagaacatggcccacaaaaaacgcttt
gccgcccaggtgataaaacgctttgagtctgccgttcaggactttgccgggaatgctgcg
acaatacagcgcgatgctttgctgggagagctggcaaaactggcacagtgctggcaggcg
cacaacgcgtctgagctggcaaaggcgacagacgatttattttccctgtttcagcgcgcg
tttcgtgatgtagcgcctgaaatgacatcatctgcacgaagcgccgccattgcgccgcag
gccacgaccggatatgtaccggatatgtcaccgcacacggttgccgctcagcctcctgtt
gcagccactccaatcccgcaggtcaccgttgaaagccacgacgataaagcatggcgcgac
accctgctaaaggtggccgccattctctgtgagcgccagccggagtcaccgcagggttac
cgactgcgccgccatgcgctgtggcaaaccatcaccagtaccccgcaggcagaaagcgat
ggccggaccccactggcagccttccctgtcgatatgatggatgattacctggcgcggctg
aacaatgccgacatggcgctgtggcagcaggtggaaaaaagcctgctgctggccccgtac
tggctggacggtcattacctctcagcacagaccgcgctgcgcctcggttataaacaggtg
gcggatgctatccgtgatgaagttaccgattttctggcccgcctgcccgcactgatcaac
ctgttgtttaacgaccgcactccgtttgtgtccgaacagacgaaacagtggctggcatca
tccggctcagtcaaccagaccgtcccggttgtacagaccgatgaagaattacaggcggcc
aaggcgtgcttcgatgaatacgggctggaagccgcgctgcggtacctggaaaacctgccc
gaaggtgatccccgccaccagtttcaccgccagtttttcggcgcgcagttactggaagag
gccggtatggttcagcttgcacaacagcagtaccggatgctcttcagaacaggattacac
atgatgctatccgaatgggagccttccctgctgaaagcactggaacaaaaactcacggca
gaacagtaa

DBGET integrated database retrieval system