KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0239
Entry
ECP_0239          CDS       T00373                                 

Definition
(GenBank) hypothetical hemolysin co-regulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECP_0239
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_0239
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_0239
SSDB
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Other DBs
NCBI-ProteinID: ABG68276
UniProt: A0A454A176
Position
263065..263583
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRAHKPFIFTVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATI
VDMNLHMPHCQDPAQREFTQLLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaaccccatgttacatttcaattacaggtcagacccaggggaacatcactgccggt
gctttcaccgcagattctgtcggcaatatctacgtgcagggacacgaagatgaaatgctg
gtgcaggagtttctgcataacgttactgttccaaccgatccgcagtctggtcagccttcc
gggcagcgtgctcacaaaccgttcattttcaccgtggcgctgaacaaagccgttccgctg
ctgtacaacgcgctggcctccggtgaaatgctgccgaaagtggagctgcactggtggcgt
acctctgttgaaggcaagcaggagcactacttcaccacacgtcttactgacgcgacgatt
gtggacatgaacctgcatatgccgcactgccaggaccctgcacagcgtgagtttacgcaa
ttgctcgcagtatcactggcctaccgtaaggttgagtgggagcacatcaaatccggtact
tctggtgccgatgactggcgtgcaccgctggaagcataa

DBGET integrated database retrieval system