KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0240Help
Entry
ECP_0240          CDS       T00373                                 

Definition
(GenBank) Vgr-like protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECP_0240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_0240
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF4249
Motif
Other DBs
NCBI-ProteinID: ABG68277
UniProt: A0A454A184
Position
263804..265786
Genome map
AA seq 660 aa AA seqDB search
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATL
TIWQGVIPQRYVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTIS
ATLLNENGVTEWTPLFYEDHPAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQK
LTLCDDVAGLSQAGEFPFNPDASTGAETECVSMFRYEAHVRPSSVQSQDYTFKVPDWPGM
YEQQGESLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMESLRSDAEKATGQSNSPKLWPG
TRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIPADRTWRPRLQ
SKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGF
NELRFEDATGGEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKITVGLGQTVNVGS
KKEGGHDQKVTVANDQHLTIKNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKV
EHGTNIISGDSIELICGQGESGTCSIKLEKTGKIIIRGTEFLFEATGPVDIKGKDIHLNG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaaaaggtcttcgctttacgctggaggttgacggccaggagccggacaccttt
gcagtggtgaatttcaggttaatccagaaccagtcttatccgtttgtgatgagtgtggat
gtcgccagcgattcttttatgcagacggcggagatgctgctggagaagaaggcaacgctg
accatctggcagggcgtcatcccgcagcgttatgtcacaggcgtggtagcagggtttggt
atgcaggagaataacggctggcagatgcgttatcacctgcgtattgagccgccgttatgg
cggtgcgggctgcggcagaacttccgcatcttccagcagcaggatatccggacgatatcg
gccacgttactgaacgagaacggcgtcacggagtggacgccgctgttttatgaggaccat
ccggcgcgggagttctgtgtccagtacggggaaagcgacctggcgtttctggcgcggctg
tgggcggaggagggtattttcttctttgagcggtttgcggcggacagtccggagcagaag
ctgacgctgtgcgacgatgtggcggggctgtcacaggcgggagagtttccgtttaacccg
gacgcatcgacaggagcggagacggagtgtgtcagtatgttccgttatgaggcgcatgtc
cgcccgtcgtcggtgcagagccaggattacacgtttaaggtgccggactggccggggatg
tatgagcagcagggtgagagcctgaacggacagcttgaacagtatgaaatatttgattat
ccgggaaggttcaaggatgagcagcacggcaaggatttcacgctgtaccagatggagagc
ctgcgcagtgatgcggaaaaggccacagggcagagtaattcgccgaagctgtggccggga
acgcggtttacgctgacggggcatccgcagaagatgctgaaccgtgaatggcaggtggta
cagagcattctgtcaggagaccagccgcaggcgcttcacggcagccaggggagaggaacc
acgctgggcaatcagttagaggtgataccggcagaccggacgtggcgtccacggctgcaa
agcaaaccgaaggtggacgggccacagagcgccattgtcaccggtcctgcgggagaggaa
atcttctgcgacgaacatggccgggtacgggtgaagtttcactgggacaggtataacccg
gcaacggaggcgagttcgtgctgggttagggtatcgcaggcgtgggcggggccggggttt
ggtaacctggcgataccgcgcgtgggccaggaggtgattgttgacttcctgaacggggac
ccggaccagccgataatcatggggcggacgtaccatgaggacaaccgttcgccggggagc
ctgccggggacgaagacgcagatgacgatacggtcgaagacctataaaggaagcgggttt
aacgagctgcggtttgaagacgccacgggcggtgaacaggtctatatccacgcgcagaag
aacatggatacggaggtgctgaataatcggacgacggatgtgaaggctgaccacacggag
accattggtaacgaccagaagataacggtggggttgggccagacggtgaatgtggggagc
aaaaaggaaggtggtcatgaccagaaagtgacggtagcgaacgatcagcatctcacgata
aaaaatgaccggcacaaggttgtaaataacaaccagacaagcaaggtgacgggaactgat
accgaagaagtcgtcaaaaaacagagtattaaaataggtgataattacgaactgaaagtt
gagcatggtacaaatatcatatctggggacagtattgagctaatttgtgggcagggagag
agcgggacttgttccataaaactggagaaaacaggaaagataataatacgggggacggag
tttctatttgaggctaccggtcctgtagatattaaaggaaaagatattcatctgaacgga
tag

DBGET integrated database retrieval system