KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0601Help
Entry
ECP_0601          CDS       T00373                                 

Definition
(GenBank) probable two component sensor histidine kinase transcription regulator protein
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECP_0601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecp01001]
    ECP_0601
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecp02022]
    ECP_0601
   01504 Antimicrobial resistance genes [BR:ecp01504]
    ECP_0601
Enzymes [BR:ecp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECP_0601
Protein kinases [BR:ecp01001]
 Histidine kinases
  OmpR family
   ECP_0601
Two-component system [BR:ecp02022]
 OmpR family
  CusS-CusR (copper tolerance)
   ECP_0601
Antimicrobial resistance genes [BR:ecp01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    ECP_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ABG68629
UniProt: A0A454A220
Structure
PDB: 

Position
complement(630847..632289)
Genome map
AA seq 480 aa AA seqDB search
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER
VLNHPDETQTRRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGAPDIREFTRDAIPDKDA
QAGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI
NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE
LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV
LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL
RFVGDECQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVTVENPGTPIA
PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDVRGTKFVIILPA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtaagccatttcagcgcccgttttcgctggcaacccgtctgaccttttttatc
agcctcgccaccatcgcggcgtttttcgcctttgcatggatcatgatccactcggtaaaa
gtgcattttgccgagcaggatattaatgatttaaaggagattagcgccacccttgaacgg
gtacttaatcaccctgacgaaacgcaaacccgacgcttaatgacgctggaagatatcgtc
agtggttattccaatgtgttgatctccctggcagatagccacggtaaaacggtgtatcac
tcccccggtgcgccggatatccgcgagtttacgcgtgacgccatacccgataaagacgcg
caggctggcgaggtgtatctcctttccggcccgacgatgatgatgccagggcacggtcac
gggcatatggaacacagcaactggcggatgattaacttgccggttggcccgctggttgac
ggcaaaccgatttatacgctctacatcgcgctttcgatcgattttcatcttcattacatc
aatgatttgatgaataaacttattatgaccgcatcggtaatcagcatcctgatcgtcttt
atcgtgctgttggcggtacataaaggtcacgcgccgatccgcagcgtcagccgtcaaatc
cagaatatcacctcgaaagatctcgacgttcgccttgacccgcagaccgtacccattgag
ctggaacagctggtactgtcgttcaaccatatgatcgagcgtattgaggatgtctttacc
cgccagtccaatttctcagcggatatcgcccacgaaattcgcacacctattactaatctc
attacgcaaacggaaatcgccctcagccagtcgcgcagccagaaggagctggaagatgtg
ctctactctaatctcgaagagctgacgcgaatggcgaaaatggtcagcgatatgctgttt
ctcgctcaggccgataacaaccagctaatccccgaaaagaaaatgctcaacctggcggat
gaagtcggcaaagtgttcgattttttcgaggcgttagcagaagatcgcggcgtggagctg
cggtttgttggcgacgagtgtcaggttgcgggcgatccgctgatgctgcgtcgggcgtta
agcaacctgctttctaatgccctgcgttatacgccaaccggagagacaattgtagtgcgc
tgtcagacggtcgatcacctggtgcaagttaccgtcgaaaaccctggtacgcccattgcg
cctgagcacttaccgcgattgtttgaccgtttctaccgcgttgatccttcccgccagcga
aaaggcgaaggtagcggcattggcctggcgatagtgaaatcgattgttgtcgcgcataaa
ggcacagttgcagtaacgtcagatgtgcgggggacaaagtttgttatcatattacccgct
taa

DBGET integrated database retrieval system