KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1035
Entry
ECP_1035          CDS       T00373                                 

Definition
(GenBank) curli major subunit CsgA
  KO
K04334  major curlin subunit
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECP_1035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_1035
Secretion system [BR:ecp02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   ECP_1035
SSDB
Motif
Pfam: Curlin_rpt
Other DBs
NCBI-ProteinID: ABG69048
UniProt: A0A454A2Z9
Position
1095325..1095783
AA seq 152 aa
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALAL
QADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSTMTVKQFG
GGNGAAVDQTASNSSVNVTQVGFGNNATAHQY
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaacttttaaaagtagcagcaattgcagcaatcgtattctctggtagcgctctggca
ggtgttgttcctcagtacggcggcggcggtggcaaccacggtggtggcggtaataacagc
ggcccgaattcagagctgaatatttaccagtacggtggcggtaactctgctcttgctctg
caagctgacgcccgtaactctgatctgaccattacccagcacggcggcggtaatggcgca
gatgtgggccaaggttctgatgacagctcaatcgatctgactcagcgtggtttcggcaac
agcgctactcttgatcagtggaatggtaaagattctactatgactgttaaacagttcggt
ggcggtaacggtgctgctgttgaccagactgcatctaactccagcgttaacgtcactcag
gttggctttggtaacaacgcgaccgctcatcagtactaa

DBGET integrated database retrieval system