KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_1670Help
Entry
ECP_1670          CDS       T00373                                 

Definition
(GenBank) 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00010  Glycolysis / Gluconeogenesis
ecp00030  Pentose phosphate pathway
ecp00051  Fructose and mannose metabolism
ecp00052  Galactose metabolism
ecp00680  Methane metabolism
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01120  Microbial metabolism in diverse environments
ecp01130  Biosynthesis of antibiotics
ecp01200  Carbon metabolism
ecp01230  Biosynthesis of amino acids
Module
ecp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_1670
   00030 Pentose phosphate pathway
    ECP_1670
   00051 Fructose and mannose metabolism
    ECP_1670
   00052 Galactose metabolism
    ECP_1670
  Energy metabolism
   00680 Methane metabolism
    ECP_1670
Enzymes [BR:ecp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECP_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ABG69673
Structure
PDB: 

Position
1720286..1721215
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVSLLAHENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctcttgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccggtggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcactgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacatctggtttcactgttggcgcatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
ctcgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtaaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacacttaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaaccagggaacacgcctgtgctcccatgacgatacg
caaaaaatttacgcgtacctttcccgctaa

DBGET integrated database retrieval system