KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2810
Entry
ECP_2810          CDS       T00373                                 

Definition
(GenBank) putative VGR-related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECP_2810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecp02044]
    ECP_2810
Secretion system [BR:ecp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECP_2810
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 Laminin_II DUF1843
Other DBs
NCBI-ProteinID: ABG70794
UniProt: A0A454A779
Position
2954805..2957324
AA seq 839 aa
MMNIPALNFDHSHHKLKIRGLKSPVDVLTFTGREQLSAPFRYDIEFTSTDKTIEPESVLM
QDGAFSLSAPPVQGMPVQTALRTLHGIITGFKLLSSSRDEARYEVRLEPRMALLTRSRQN
AIYQNLTVPQIVEKILRERHQMRGQDFVFNLKSEYPSREQVMQYGEDDLTFISRLLSEVG
IWFRFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLHDGATEAVWGLNTAYSVVEKS
VTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQKGDKEAAESGAFYARIRH
ERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASAARDRSYELTFT
AIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPG
YESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQN
DKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDL
WGAVRAKKGIFISADAQDKAQGQVREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSS
QIALLQQSVKDLTQAAILLSAPKGVAIASGEHLQLAASKNLIANAGNHADIGVVKNMFIG
VGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKSIEITSTEDEIKITAKKKITLN
GGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIESGEFNAKFLFTDD
DGLPYANTKYIACFSDGTQKEGITDENGYTENFNTDSKQTIDVRLLNQNIDMILGGVHE
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgatgaatattcctgccctaaactttgaccactcacaccacaagctcaaaattcgcggc
ctgaaaagcccggtggacgtgctgacgtttacgggccgggaacaactcagcgcacccttc
cgctacgacattgaatttaccagtaccgataaaaccatcgagccggagtcggtgctgatg
caggatggcgcattcagcctgagcgccccgccggtacagggcatgccggtacagactgcc
ctgcgcaccctgcacggcatcatcaccggctttaaacttctctcctcgtcacgcgacgaa
gcccgttacgaagtgcgtcttgaaccccgtatggcgctgcttacccgcagccgtcagaac
gccatttaccagaatctgacggtaccgcaaatcgtcgaaaaaatcctgcgcgagcggcac
cagatgcgcggtcaggacttcgtgtttaacctcaaaagcgaatacccgtcccgtgaacag
gtgatgcagtacggtgaggacgacctgacgtttatttcacgcctgctgtcggaagtgggt
atctggttccgctttgccaccgacgcccggctgaaaattgaggttatcgagttttacgac
gaccagagtggctatgagcgcgggctgacgttgccactgcgccatccttcagggctacac
gacggagccacggaagcggtatgggggctgaacaccgcgtacagcgtggtggaaaaaagc
gtcaccacgcgggactacaactaccgcaccgccacggcggagatgatgacagagcagcat
gacgccaccgggggcgataacaccacctacggcgaagcctatcactacgccgacaacttc
ctgcaaaaaggcgataaagaggcagcggaaagcggcgcgttttacgcccgtatccgccac
gaacgctacctgaatgaacaggctattctcaaaggtcagagcaccagttcactgctgatg
ccggggctggagataaaagttcagggcgacgacgcgccagcggtgttccgcaagggcgta
ctgattaccggcgtgacggccagcgcggcgcgtgaccgcagctatgaactgacgtttacc
gctattccgtattcagagcgctatggctaccgcccggcgcttatcccccgccccgtaatg
gccggcacgctcccggcgcgggtcaccagcacggtgaagaacgatatctatgcccatatc
gacaaggacgggcgctaccgggtcaaccttgactttgaccgcgatacgtggaaaccgggt
tatgaaagcctgtgggtgcgccagtcgcgcccgtatgcgggagacacctacggcctgcac
ttgccgctgctggcgggaacggaagtgagtatcgcctttgaggaaggcaacccggacagg
ccgtatatcgccggggtaaagcacgactcggcgcacaccgaccatgtgaccatccagaac
gacaagcgcaacgtgctgcgcacccctgccaacaacaaaatccggctggatgatgagcgc
ggcaaagagcatatcaaggtcagtaccgagtacggcggcaagagccagctaaacctcggt
catctggtggacgccgggaaacagcagcgcggggaaggctttgaactgcgtaccgatctg
tggggcgcggtgcgggcaaagaaaggcatctttatcagcgccgacgcgcaggacaaggcg
cagggtcaggtgcgcgaaatggctccggcgatggcaatactggatggcgcacagtcacag
atgaagtcgctgtccactgatgcgcagacggcgaatgccgatccggcagatctgtcatca
cagatagcgctgttgcagcagagtgtaaaagatctgacgcaggcggcgatcctgctaagc
gcccccaagggcgtggcgatcgccagcggcgagcacctgcaactggcggcatcgaaaaac
ctgatcgcgaacgcaggaaatcacgctgacatcggtgttgtgaagaatatgtttatcggt
gtgggtcaggcgctgagcgtgtttgtacgcaaagcgggtatcaaactgtttgccaataaa
ggggcgatctcggtacaggcacagaacgatctgatggaactgttggcacagaaatcgata
gagatcaccagtacggaagatgagatcaagatcaccgcgaagaagaaaatcacccttaac
ggcggtggcagctacatccggctggatgcctgcgggatagaagcgggaacgccgggagaa
tataacgttaaggccggatattacgggcgtaaaccaaaggcgaagctgacgccggagttg
atggcgtttccagtgattgagagcggggaatttaatgctaagttcctttttactgatgat
gatggtctaccttatgccaacacaaaatatattgcatgtttttctgatggcactcaaaaa
gaaggtattactgatgagaatgggtatacagaaaattttaatactgattccaaacaaaca
attgatgtcagattattgaatcaaaatatagacatgatattgggaggcgtgcatgagtaa

DBGET integrated database retrieval system