KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2860
Entry
ECP_2860          CDS       T00373                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00230  Purine metabolism
ecp01100  Metabolic pathways
ecp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECP_2860
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECP_2860
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF4694
Other DBs
NCBI-ProteinID: ABG70844
UniProt: A0A454A7C1
Position
3019369..3021666
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITSPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFIGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagtcctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
aggagtttgccgggcgtcctggcgatttttacctgggaagatgtgccagaaatcccattc
gccacggcagggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgcgca
ctgctaactcgccatgttcgtcatcatggcgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcacctcgccagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagactcccgttattcaacattgtcatatggaaagcgtg
acatcgctggcatggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttatcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgaccagcaaacttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccattgcttctgctggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgat
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggaaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagagtgccagaaccagcaa
ggcaatttacgtcgtggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgcctgttgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggccagggtgccgacaccgtgttctcgcaaatggtggca
gaaaccgtgggagttccggtcagcgatgtccgcgtaatttcgacacaagacaccgacgtt
acaccattcgaccccggcgcatttgcctcacgtcagagctatgttgccgcgcctgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgccgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcactgtgtaaagtcaccatcaaccgcatcctc
aacgttcatgattcgggccatattcttaatccgctgctggcagaaggtcaggtacacggc
ggaatggggatgggcattggctgggcgctatttgaagagatgatcatcgatgcgaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccacccataattcctgtagccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctaacgccaaaacgattatatgaagaattccat
ctggcaggattgatttga

DBGET integrated database retrieval system