KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2862
Entry
ECP_2862          CDS       T00373                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00230  Purine metabolism
ecp01100  Metabolic pathways
ecp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECP_2862
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ABG70846
UniProt: A0A454A737
Position
3022552..3023031
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggtggaaaactttctcatgtccaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system