KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_3063Help
Entry
ECP_3063          CDS       T00373                                 

Definition
(GenBank) hypothetical aminotransferase, class II
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00780  Biotin metabolism
ecp01100  Metabolic pathways
Module
ecp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECP_3063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecp01007]
    ECP_3063
Enzymes [BR:ecp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     ECP_3063
Amino acid related enzymes [BR:ecp01007]
 Aminotransferase (transaminase)
  Class II
   ECP_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase OKR_DC_1 Flg_hook Speriolin_C
Motif
Other DBs
NCBI-ProteinID: ABG71046
UniProt: A0A454A7L2
Position
3228199..3229371
Genome map
AA seq 390 aa AA seqDB search
MGLYDKYARLAGERLQFSDNGLTPFGTCIDEVYSATEGRIGNKKVILAGTNNYLGLTFNH
DAIAEGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRPTAIVFSTGYTANLGVI
SALADHNAVVLLDADSHASIYDACSLGGAEIIRFRHNDAKDLERRMVRLGERAKEAIIIV
EGIYSMLGDVAPLAEIVDIKRRLGGYLIVDEAHSFGVLGATGRGLAEAVGVEDDVDIIVG
TFSKSLASIGGFAVGSEAMEVLRYGSRPYIFTASPSPSCIATVRSSLRTIASQPELRQKL
MDNANHLYDGLQKLGYELSSHISPVVPVIIGSKEDGLRIWRELISLGVYVNLILPPAAPA
GITLLRCSVNAAHSHEQIDAIIQAFATLKQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggggctatacgataaatatgcgcgtcttgctggcgagcgactgcaatttagtgacaac
gggttaacgccgtttggtacctgtattgatgaagtgtattccgccaccgaaggccggatc
ggcaataaaaaagtgattctggccgggaccaataattatctcggtttaacctttaatcat
gatgccatcgccgaaggtcaggcagcgttagcggcccaaggcaccggcaccaccggttct
cgtatggcaaacggcagttatgcgccgcacctggcgttagagaaagagattgccgagttt
ttcaatcgccctaccgctatcgttttttcaaccggttataccgctaatttaggcgtcatc
agcgcacttgccgaccataacgccgtggtgttactggatgccgacagccacgccagtatt
tatgacgcctgttctctcggtggcgcggaaattattcgtttccgccataacgatgctaaa
gatctggaacggcgcatggttcgcctcggtgaacgggcgaaagaggcgattatcatcgtt
gagggcatctacagcatgctcggtgacgttgcgccgttagcggaaattgttgatatcaaa
cgtcgtctcggtggttatttgattgtcgatgaagcgcattcgtttggcgtgttaggcgca
acggggcgcggactggctgaagccgttggcgttgaagatgatgtggatattatcgttggt
actttcagtaaaagtctggcctcgattggcggttttgctgtcggttcggaagcgatggaa
gtgttgcgctacggcagccgcccgtatatttttaccgcctctccttctccgtcctgcatt
gcgaccgtgcgctcgtcgttaagaaccattgcctcacaaccagagctgcggcaaaagctg
atggataacgccaaccatctgtatgacggtctgcaaaaactgggttatgagttaagttca
catattagcccggtagtgccggtaataatcggttcgaaagaggacggtttacgcatctgg
cgcgagcttatttcgctgggcgtttatgtgaatcttatcctgccacctgccgcgcctgca
ggcatcactctgctgcgctgtagcgtaaacgctgcccacagtcatgagcaaatcgatgcc
atcattcaggcatttgctactctgaagcagtaa

DBGET integrated database retrieval system