KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_3218Help
Entry
ECP_3218          CDS       T00373                                 

Definition
(GenBank) D-galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00053  Ascorbate and aldarate metabolism
ecp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ECP_3218
Enzymes [BR:ecp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     ECP_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-ProteinID: ABG71200
UniProt: A0A454A859
Structure
PDB: 

Position
3388812..3390383
Genome map
AA seq 523 aa AA seqDB search
MANIKIRQETPTAFYIKVHDTDNVAIIVNDNGLKAGTRFPDGLELIEHIPQGHKVALLDI
PANGEIIRYGEVIGYAVRAIPRGSWIDESMVVLPEAPPLHTLPLATKVPEPLPPLEGYTF
EGYRNADGSVGTKNLLGITTSVHCVAGVVDYVVKIIERDLLPKYPNVDGVVGLNHLYGCG
VAINAPAAVVPIRTIHNISLNPNFGGEVMVIGLGCEKLQPERLLTGTDDVQAIPVESASI
VSLQDEKHVGFQSMVEDILQVAECHLQKLNQRQRETCPASELVVGMQCGGSDAFSGVTAN
PAVGYASDLLVRCGATVMFSEVTEVRDAIHLLTPRAVNEEVGKRLLEEMEWYDNYLNMGK
TDRSANPSPGNKKGGLANVVEKALGSIAKSGKSAIVEVLSPGQRPTKRGLIYAATPASDF
VCGTQQVASGITVQVFTTGRGTPYGLMAVPVIKMATRTELANRWFDLMDINAGTIATGEE
TIEEVGWKLFHFILDVASGKKKTFSDQWGLHNQLAVFNPAPVT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcaaaatcagacaagaaacgccaactgcgttttatataaaagttcacgac
acagataatgtggcaattattgttaatgataatggcctgaaagcaggaacgcgttttccg
gatgggctggaattaattgaacatattccccaggggcataaagtcgcattgctggacatt
ccggctaatggtgaaattattcgttatggcgaggtgattggttacgccgtgcgcgcaatc
ccacgcggaagctggatcgacgaatcaatggttgtactaccggaagcgccgccgttacat
acgctgccactggcaaccaaagtcccggaacccttaccgccgctggaaggatacaccttt
gagggctatcgcaatgccgatggcagcgtgggcaccaaaaacctgctcggcatcaccacc
agcgtccactgtgtggcaggcgtggtggactacgtagtaaaaatcattgaacgcgatctg
ctaccgaaatacccgaacgtcgatggcgtggtggggctgaatcatttgtacggttgtggc
gtggcgattaacgcacccgcggcagttgtacctattcgtaccattcacaatatttcgctg
aaccctaactttggcggcgaagtaatggtgattggtctgggttgtgaaaagttgcagcct
gaacgcctactgactggaacggatgatgtgcaagctattccagtagaaagcgccagcatt
gtcagtttgcaggatgaaaagcatgtcggttttcagtccatggtcgaggatattttgcag
gtcgccgaatgccatctacaaaaactgaatcaacgtcagcgagaaacctgtccggcttca
gaactggttgtcggcatgcagtgcggtggcagcgatgcgttttctggcgtaacggcaaac
ccggcggttgggtatgcgtctgatctattggtgcgctgcggcgcaacggtgatgttttca
gaagtcacagaagtgcgtgacgcgatacatttgctgacaccacgcgctgtgaacgaagag
gtcggcaaacggctgctggaggagatggagtggtacgataactatctcaatatgggaaaa
accgatcgcagcgccaacccttcgccggggaacaagaaaggcggtctggcaaatgtggtg
gagaaggcactcggctccattgctaaatcgggtaaaagtgcaattgttgaagtgctgtcg
cccggccaacgcccgactaaacgcggattaatttacgccgcgacgccagccagcgatttt
gtctgtggcacgcaacaggtggcttcgggtatcaccgtgcaagtgtttacgaccggtcgt
ggtacgccgtacggcctgatggcggtacccgtcattaaaatggcgacccgcaccgagctg
gcgaaccgctggtttgatttaatggatattaacgcgggcactatcgctaccggcgaagaa
accattgaagaagtgggctggaagttgttccactttattctcgacgtcgccagcgggaag
aagaaaactttctcggatcaatggggactgcataaccagctggcagtgtttaacccggca
ccggtgacctga

DBGET integrated database retrieval system