KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_3687Help
Entry
ECP_3687          CDS       T00373                                 

Definition
(GenBank) putative hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00040  Pentose and glucuronate interconversions
ecp00053  Ascorbate and aldarate metabolism
ecp01100  Metabolic pathways
ecp01120  Microbial metabolism in diverse environments
Module
ecp_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECP_3687
   00053 Ascorbate and aldarate metabolism
    ECP_3687
Enzymes [BR:ecp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     ECP_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 UxuA Methyltransf_11 PRMT5_TIM DPRP
Motif
Other DBs
NCBI-ProteinID: ABG71661
UniProt: A0A454A961
Position
3862907..3863767
Genome map
AA seq 286 aa AA seqDB search
MRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLDWSAAQRASLVT
AMIETGVAIPSMCLSAHRRFPFGSRDDAVRQRAREIMSKAIRLARDLGIRTIQLAGYDVY
YEDHDEGTQQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKWDEMLASPWFTV
YPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTEHSPGQFRDVPFGEGCVDFVGIF
KTLHELNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaatcatccgttaggcatttatgaaaaagcgctggcgaaagatctctcctggccg
gagcggctggtactggcaaaaagctgtggttttgattttgtcgaaatgtcggtggatgaa
accgacgaacggttgtcacgtcttgactggagcgccgcacaacgtgcttcgctggtcact
gcgatgatcgaaacgggtgttgctattccgtcaatgtgcctgtccgcacatcgtcgtttt
ccttttggtagccgggacgacgccgtgcgccagcgggcgcgggagattatgagtaaagcg
attcgcctggcgcgcgatctcggcattcgtactattcaactggcaggttacgacgtctat
tacgaggatcatgacgaaggcacccagcaacggtttgctgaagggctggcgtgggcggtt
gaacaggcagcggcatcacaagtcatgctggcggtggagattatggacaccgcgtttatg
aactctatcagcaaatggaaaaagtgggacgaaatgcttgcgtcaccgtggttcaccgtt
tacccggacgtaggcaatctcagcgcctggggcaatgatgttcccgccgaactgaaactg
ggcatcgaccgtatcgccgccatccacctgaaagacactcaacccgttaccgaacatagc
cccggacagttccgcgatgtgccgtttggcgaaggctgtgtcgattttgttggcatcttc
aaaacgctgcatgagctgaactatcgcggatcatttctgattgaaatgtggaccgaaaaa
gccaaagaaccggtgctggagattattcaggcgcggcgctggattgaagcgcgtatgcag
gaggccggatttatatgttag

DBGET integrated database retrieval system