KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4094Help
Entry
ECP_4094          CDS       T00373                                 

Definition
(GenBank) hypothetical protein YihX
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00010  Glycolysis / Gluconeogenesis
ecp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECP_4094
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ECP_4094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: ABG72052
UniProt: A0A454AA06
Structure
PDB: 

Position
4277858..4278457
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRVPLATLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPDDTVFFDDNADNIEGANRLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtgttccactggctacgcttaagaagagtttccacatg
ggcgaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggctctaccgctaagctacgagcagttctctcacggctggcaggcg
gtgtttgtcgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaatactaaccgcctgcatactaccttctggccggaggaa
tacccggaaatccgtgatgctgctgaccatatctatctgtcgcaagacttgggtatgcgc
aaacctgaagcacgaatttatcagcatgttttgcaggcagaaggtttttcaccagacgat
acggtctttttcgacgataacgccgataatatagaaggagctaatcggctaggcattact
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system