KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4223Help
Entry
ECP_4223          CDS       T00373                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00270  Cysteine and methionine metabolism
ecp00920  Sulfur metabolism
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01130  Biosynthesis of antibiotics
ecp01230  Biosynthesis of amino acids
Module
ecp_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECP_4223
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECP_4223
Enzymes [BR:ecp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ECP_4223
    2.3.1.46  homoserine O-succinyltransferase
     ECP_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ABG72173
UniProt: Q0TA56
Position
4425173..4426102
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVNFLREENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQEQNFDGLIVTGAPLGLVEFNDVAY
WPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYEHHILHPHALLT
RGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDA
QTLAQEYFRDVEAGLDPDVPYNYFPHNDPQNTPRASWRSHGNLLFTNWLNYYVYQITPYD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgtgtgccggacgagctacccgccgtcaatttcttgcgtgaagaaaacgtc
tttgtgatgacaacttctcgcgcgtctggtcaggaaattcgtccgctaaaggtgcttatc
cttaacctgatgccgaagaagatcgaaactgaaaatcagtttctgcgcctgctttcaaac
tcacctttgcaggtcgatattcagcttttgcgcatcgattcccgtgaatcgcgcaacacg
cccgcagagcatctgaataacttctactgtaactttgaagatattcaggaacaaaacttt
gacggtctgatagttaccggcgcgccgctgggcctggtggagtttaatgatgtcgcttac
tggccgcagatcaaacaggtgctggagtggtcgaaagatcacgtcacctcgacgctgttt
gtctgctgggctgtacaggccgcgctcaatatcctctatggtattcctaagcaaacccgc
accgacaaactctctggcgtttacgagcatcatattctccatcctcatgcgcttctgacg
cgtggctttgatgattcattcctggcaccgcattcgcgctatgctgactttccggcagcg
ttgattcgtgattataccgatctggaaattctggcagagacggaagaaggggatgcatat
ctgtttgccagcaaagataagcgcattgcctttgtgacgggccatcccgaatatgatgcg
caaacgctggcgcaggaatatttccgcgatgtggaagccgggctagacccggatgtaccg
tataactatttcccgcacaatgatccgcaaaatacaccgcgagcgagctggcgtagtcac
ggtaatttgctgtttaccaactggctcaactattacgtctaccagatcacgccatatgat
ctacggcacatgaatccaacgctggattaa

DBGET integrated database retrieval system