KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4277Help
Entry
ECP_4277          CDS       T00373                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00020  Citrate cycle (TCA cycle)
ecp00640  Propanoate metabolism
ecp00660  C5-Branched dibasic acid metabolism
ecp01100  Metabolic pathways
ecp01110  Biosynthesis of secondary metabolites
ecp01120  Microbial metabolism in diverse environments
ecp01130  Biosynthesis of antibiotics
ecp01200  Carbon metabolism
Module
ecp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECP_4277
   00640 Propanoate metabolism
    ECP_4277
   00660 C5-Branched dibasic acid metabolism
    ECP_4277
Enzymes [BR:ecp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECP_4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABG72225
UniProt: A0A454AAC0
Position
4486225..4487394
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQQISQLADAWQHIACPSKGAVLKAQVHAGGRGKAG
GVKVLKQLPEAQAFVQQMLGSQLVTYQTGPEGQYVSSILLCENIYPVRQELYFGMVVDRE
SQRVTFIVSPEGGVEIEKVAHETPEKISSVSIDPLTGVQPCHIREMFAVLQLEHGLFAAF
SRLVNQAWKAFNELDFALLEINPLVLRETGEFMCADAKVSLDDNALYRHPELQVLRDETQ
EDPRESQAAKLDLNYVSLDGNIGCMVNGAGLAMATMDIIKLYGEQPANFLDVGGGATQER
VSEAFRLIVSDSKVKAILVNIFGGIVRCDMIARAIIHALNEARITLPVVVRLSGNNAAEG
QRLLAESGLTVEAVDSLDDAAKRIIALLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggccaaatcgttactggctggcatggggatgccgtgtcca
aaagagatagccatccaacagatttcgcaactggcagatgcctggcaacatattgcttgc
ccgagtaaaggcgcggtacttaaagcgcaggtacatgctggtgggcgcggtaaagctggc
ggcgtaaaagtgcttaagcagctgccggaagcacaggcttttgtacagcaaatgttggga
tcgcaactggtgacttatcagaccgggccagaaggacagtatgtcagcagtattttactg
tgcgaaaacatttatccggtacgccaggaactctattttggcatggtggtggatcgtgaa
agccagcgggtcacgtttattgtcagcccggaaggtggtgtggaaattgaaaaagtcgcc
catgagacaccggagaaaatcagcagtgtcagcattgatccactgacaggcgtgcagcct
tgccatatccgcgaaatgtttgctgttctgcaactggaacacggactatttgctgccttt
agtcgcctggttaatcaggcgtggaaagcctttaacgaactggatttcgccctgctggaa
attaaccctctggtgttgcgggaaacgggcgaatttatgtgtgcagacgcgaaagtatcg
ctggatgataacgcgctgtatcgtcacccggaactccaggtgctacgtgatgaaacccag
gaagatccacgcgaaagccaggcagcgaagcttgatcttaattatgtctcgctggacgga
aatatcggctgcatggtcaatggtgcagggctggctatggcaaccatggacatcatcaag
ctatacggtgaacaacccgcaaacttcctggatgttggcggtggcgcaacccaggagcgc
gtcagtgaagcctttcggctgattgtttccgacagcaaagtgaaagccattctggttaat
atttttggtgggattgtccgttgcgacatgatcgccagagccattattcatgctctgaat
gaggcccgtatcaccctgcctgtcgtggtgcgtctctccggtaataacgctgccgaaggg
cagcggttactggcagaaagtggcctgacggtggaagccgtcgattctctggatgatgcc
gcgaaacgcatcattgcgttactgaattaa

DBGET integrated database retrieval system