KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0235Help
Entry
ECED1_0235        CDS       T00827                                 

Definition
(GenBank) conserved hypothetical protein Aec22
  KO
K11895  type VI secretion system protein ImpH
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecq02044]
    ECED1_0235
Secretion system [BR:ecq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECED1_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: CAR06450
UniProt: B7MQ38
Position
complement(257714..258763)
Genome map
AA seq 349 aa AA seqDB search
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSS
DASISFPGTDLSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEF
LDLFSHRWTQFAYHAWRKYRYYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKML
AYAGILATPGRAPEVICNLVSHCFDLPDVTIERWQLRKVAIDPAHQNRLGVRNPKGKTAG
HIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSFLPDGENHLPLTMFLSFILRD
QFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVPPAITIRIRE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaaaatgggccagcacgccctgatatagcgacaaaaccgccgttaccggcg
gatgtgcgcaactgcaatttctatgtgctgatggaggcgctgtaccgtcggcatggcgcg
ccgggccaggacatttccctgcgtaccgagcctgcccgggagatcgtgcgtttcagctct
gacgccagtatcagttttccgggtacggacctgagtgcgctttcccgtagccagaacgga
cagtatgtactgcaaacccggttcctgggtttttccggcagccagtcgccgctaccgggc
tattatctggatcagatggcgcaggagtccgcacagaacgaagacggcctgaaagaattt
ctcgatctattcagccaccgctggacacagtttgcctatcatgcctggcgcaaataccgc
tactacatctgctttcgtagcggcggtactgacaccttttcacagcgcatgtacgcactg
gtcgggctgggtaatcagagcgtgcgtgacaggcttgccattaaccacagcaaaatgctg
gcctacgccggaattctggcaacaccaggccgcgcgccggaggttatctgtaatctggtg
tcgcactgttttgatttgccggatgtcaccattgaacgctggcaactgcgtaaagtcgcc
attgatccggcacaccagaaccggctgggtgtacgtaatccgaaaggaaaaacggctgga
catattccgggacgctccatactcggcgttaattttaccctcggcgcacgggtgccggat
cgcagcggaaaattcctgttgcagattggcggcctgtcgcgggagcgttatctctcattt
ttacccgatggcgaaaatcacctgccgctgaccatgttcctttcctttattctgcgcgac
cagtttgcctgggatttacggctgtgcctggcgccacagcaggctaaagggatgcgcctt
ggcgatccggccagctcccgcctcggcagaaccagctttattggtcagccgaaagtaccg
cccgccatcacaatccgaatcagggaataa

DBGET integrated database retrieval system