KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0444Help
Entry
ECED1_0444        CDS       T00827                                 

Gene name
ispA
Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00900  Terpenoid backbone biosynthesis
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01130  Biosynthesis of antibiotics
Module
ecq_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECED1_0444 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ecq01006]
    ECED1_0444 (ispA)
Enzymes [BR:ecq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ECED1_0444 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ECED1_0444 (ispA)
Prenyltransferases [BR:ecq01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ECED1_0444 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: CAR06654
UniProt: B7MQD6
Structure
PDB: 

Position
complement(460924..461823)
Genome map
AA seq 299 aa AA seqDB search
MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFG
VSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTL
AFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRH
KTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARKKAQDLIDDARQSLKQLTEQSLDTSALEALADYIIQRNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttccgcagcaactcgaagcctgcgttaagcaggccaaccaggcgctgagccgt
tttatcgccccactgccctttcagaacactcccgtggtcgaaaccatgcagtatggcgca
ttattaggtggtaagcgcctgcgacctttcctggtttatgccactggtcatatgttcggc
gttagcacaaacacactggacgcacccgctgccgccgtagagtgtatccacgcttactca
ttaattcatgatgatttaccggcgatggatgatgacgatctgcgtcgcggtttgccgacc
tgccatgtgaagtttggcgaagcaaacgcgattctcgctggtgacgctttacaaacgctg
gcgttctcgattctaagcgatgccgatatgccggaagtgtcagatcgcgacagaatttcg
atgatttctgagctggcgagcgccagcggtattgccggaatgtgcggtggtcaggcatta
gatttagacgctgaaggcaaacacgtacctctggacgcgcttgagcgtattcatcgtcat
aaaaccggcgcattgattcgcgccgccgttcgccttggtgcattaagcgccggagataaa
ggacgtcgtgctctgccagtactcgacaagtacgcagagagcatcggccttgccttccag
gttcaggatgacatcctggatgtggtgggagatactgcaacgttgggaaaacgccagggt
gccgaccagcaacttggtaaaagtacctaccctgcacttctgggtcttgagcaagcccgg
aagaaagcccaggatctgatcgacgatgcccgtcagtcgctgaaacaactgactgaacag
tcactcgatacctcggcactggaagcgctagcggactacatcatccagcgtaataaataa

DBGET integrated database retrieval system