KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0635Help
Entry
ECED1_0635        CDS       T00827                                 

Gene name
phpB
Definition
(GenBank) putative phosphatase with phosphoglycerate mutase domain
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00860  Porphyrin and chlorophyll metabolism
ecq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECED1_0635 (phpB)
Enzymes [BR:ecq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     ECED1_0635 (phpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PPTA
Motif
Other DBs
NCBI-ProteinID: CAR06842
UniProt: B7MRS5
Structure
PDB: 

Position
complement(655843..656454)
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLHDVSFDLVLCSELERAQH
TARLVLSDRQLPVHIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEYQHYQNILVVSHQGVLSLLIARLIGMPAESMWHFRVDQGGWSA
IDINQKFATLRVLNSRAIGVENA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcatggtgaaacgcaagcgaatgtcgatggtctgtacagc
ggtcatgcgcccacccccctgaccgcgcgcggtattgagcaagcgcaaaatctgcatacg
ctgctacatgatgtttcctttgacctggttttatgcagtgaactggaacgggcacagcat
accgcgcgactggttcttagtgaccgccagctccccgttcatatcatccctgaactcaat
gaaatgttttttggcgactgggagatgcgacatcatcgtgacctcatgcaagaagatgcc
gaaaactatagcgcgtggtgcaatgactggcagcatgctatccccacgaacggtgaagga
tttcaggcattttcgcaacgtgtggaacgatttatcgcaaggcttagtgaatatcagcac
tatcagaatattttagtcgtcagccatcagggcgtactgagtctgttaattgctcgttta
attggcatgcctgccgagtctatgtggcatttccgcgttgaccaggggggttggagcgcc
attgatatcaaccaaaaattcgcgacgctacgcgtcctcaatagccgtgccatcggggtc
gagaatgcatga

DBGET integrated database retrieval system