KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0698Help
Entry
ECED1_0698        CDS       T00827                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00020  Citrate cycle (TCA cycle)
ecq00640  Propanoate metabolism
ecq00660  C5-Branched dibasic acid metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
Module
ecq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECED1_0698 (sucD)
   00640 Propanoate metabolism
    ECED1_0698 (sucD)
   00660 C5-Branched dibasic acid metabolism
    ECED1_0698 (sucD)
Enzymes [BR:ecq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECED1_0698 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CAR06904
UniProt: B7MPM2
Structure
PDB: 

Position
727445..728314
Genome map
AA seq 289 aa AA seqDB search
MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREA
VAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccattttaattgataaaaacaccaaggttatctgccagggctttaccggtagccag
gggactttccactcagaacaggctattgcatacggcactaaaatggttggcggcgtaacc
ccaggtaaaggcggcaccacccacctcggcctgccggtgttcaacaccgtgcgtgaagct
gttgctgctactggcgctaccgcttctgttatctacgtaccagcaccgttctgcaaagac
tccattctggaagccatcgatgcaggcatcaaactgattatcaccatcactgaaggcatc
ccgacgctggatatgctgaccgtgaaagtgaaactggatgaagcaggcgttcgtatgatc
ggcccgaactgcccaggcgttatcaccccgggggaatgcaaaatcggtatccagccgggt
cacattcacaaaccaggtaaagtgggtatcgtttcccgttccggtacgctgacctatgaa
gcggttaaacagaccacggattacggtttcggtcagtcgacctgtgttggtatcggcggc
gacccgatccctggctctaactttatcgatatcctcgaaatgttcgaaaaagatccgcag
accgaagcgatcgtgatgatcggtgagatcggcggtagcgctgaagaagaagcagcggcg
tacatcaaggaacacgttaccaagccagttgtgggttacatcgctggtgtgactgcgccg
aaaggcaaacgtatgggtcacgcaggtgcgatcattgccggtggtaaagggactgcggat
gagaaattcgctgctctggaagccgcaggcgtgaaaaccgttcgcagcctggcggatatc
ggtgaagcactgaaaactgttctgaaataa

DBGET integrated database retrieval system