KEGG   Escherichia coli O81 ED1a (commensal): ECED1_1280Help
Entry
ECED1_1280        CDS       T00827                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, specific for NADP+; e14 prophage
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00020  Citrate cycle (TCA cycle)
ecq00480  Glutathione metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
ecq01210  2-Oxocarboxylic acid metabolism
ecq01230  Biosynthesis of amino acids
Module
ecq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECED1_1280 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECED1_1280 (icd)
Enzymes [BR:ecq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ECED1_1280 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CAR07481
UniProt: B7MTR7
Structure
PDB: 

Position
1281108..1282358
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIKNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagttgttccggcacaaggcaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgaaaatccgattatcccttacattgaaggtgatggaatcggtgtagat
gtaaccccagccatgctgaaagtggtcgacgctgcagttgagaaagcctataaaggcgag
cgtaaaatctcctggatggaaatttacaccggtgaaaaatccacacaggtttatggtcag
gacgtctggttgcctgctgaaacccttgatctgattcgtgaatatcgcgttgccattaaa
ggcccgctgaccactccggttggtggcggtattcgctctctgaacgttgccctgcgccag
gaactggatctctacatctgcctgcgtccggtacgttactatcagggcactccaagcccg
gttaaacaccctgaactgaccgatatggttatcttccgtgaaaactcggaagacatttat
gcgggtatcgaatggaaagcagactctgccgacgctgagaaagtgattaaattcctgcgt
gaagagatgggcgtgaagaaaattcgcttcccggaacattgcggtatcggtattaagccg
tgttcggaagaaggcaccaaacgtctggttcgtgcagcgatcgaatacgcaattgctaac
gatcgtgactctgtgaccctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccaactggcgcgtgaagaatttggcggtgaactgatcgacggc
ggcccgtggctgaaagttaaaaacccgaataccggcaaagagatcgtcattaaagacgtg
attgctgatgcattcctgcaacagatcctgctgcgtccggctgaatatgatgttatcgcc
tgtatgaacctgaacggtgactacatttctgacgccctggcagcgcaggttggtggtatc
ggtatcgcccctggcgcaaacatcggtgacgaatgcgccctgtttgaagccacccacggt
actgcgccgaaatatgccggacaggacaaagtaaacccaggctctattattctctccgct
gagatgatgctgcgccacatgggttggactgaagccgcagacctgattgttaaaggtatg
gaaggcgcaatcaatgcgaagaccgtaacctatgacttcgaacgtctgatggaaggcgct
aaactgctgaaatgttcagagtttggtgatgcgatcatcaagaatatgtaa

DBGET integrated database retrieval system