KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2267Help
Entry
ECED1_2267        CDS       T00827                                 

Definition
(GenBank) putative type IV secretory pathway VirB8 component
  KO
K03203  type IV secretion system protein VirB8
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq03070  Bacterial secretion system
Module
ecq_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECED1_2267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecq02044]
    ECED1_2267
Secretion system [BR:ecq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   ECED1_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CAR08454
UniProt: B7MWI8
Position
2204968..2205651
Genome map
AA seq 227 aa AA seqDB search
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGMGLLIAVLALVAVVVMLPLKQTDVELY
TLDNHTGRVEHVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQ
VNDDYLALYAGKNAPDKVYKNGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNS
TRNEYWDARFTFHSNPDKEMSDAEREINYFGFTVTSWQTDREIRGGE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagaaattaatagctgaatcccgcacttttgagcagcaaatgattgagcgg
gataaacgcgccacaaaagccggttttgttgttggcggtatgggtctgctgattgcggta
ctggcgctcgtcgccgtggtcgtgatgttgccgctgaaacagacggacgttgagctgtat
accttggataaccacacaggacgggtggaacacgttacccggacatcgaaaaccagcctg
accgcaacagaagcctatcaaaaggcgatggccgcaaactacgtcaaagtgcgtgagcgg
tatgtctatccctctttgcaggacgactacgagacggtacaggtctacaacgctccccag
gtaaacgatgactatctggcgctttacgccggaaaaaacgccccagacaaggtttataag
aacggggcgcacaccgtgaaagtggagatcttgtccaaccagatcaccgatgcgacagcc
cctgatagggtcgccaccatccgctacaagaagattatccgccgtctggctgataacagc
acccgcaacgaatattgggatgcccggttcacgttccattctaaccctgacaaggaaatg
agcgatgcggaacgcgagatcaactacttcggctttaccgtcaccagttggcagaccgac
cgcgaaatccggggaggtgaatga

DBGET integrated database retrieval system