KEGG   Escherichia coli O81 ED1a (commensal): ECED1_2804Help
Entry
ECED1_2804        CDS       T00827                                 

Gene name
yfcX
Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00071  Fatty acid degradation
ecq00280  Valine, leucine and isoleucine degradation
ecq00281  Geraniol degradation
ecq00310  Lysine degradation
ecq00362  Benzoate degradation
ecq00380  Tryptophan metabolism
ecq00410  beta-Alanine metabolism
ecq00640  Propanoate metabolism
ecq00650  Butanoate metabolism
ecq00903  Limonene and pinene degradation
ecq00930  Caprolactam degradation
ecq01040  Biosynthesis of unsaturated fatty acids
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
ecq01212  Fatty acid metabolism
Module
ecq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECED1_2804 (yfcX)
   00650 Butanoate metabolism
    ECED1_2804 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    ECED1_2804 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    ECED1_2804 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECED1_2804 (yfcX)
   00310 Lysine degradation
    ECED1_2804 (yfcX)
   00380 Tryptophan metabolism
    ECED1_2804 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECED1_2804 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECED1_2804 (yfcX)
   00281 Geraniol degradation
    ECED1_2804 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECED1_2804 (yfcX)
   00930 Caprolactam degradation
    ECED1_2804 (yfcX)
Enzymes [BR:ecq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECED1_2804 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECED1_2804 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECED1_2804 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAR08982
UniProt: B7MY16
Position
complement(2743512..2745656)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPRGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCDRLVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggaatttgcctcgcaggtacgc
gccattattaagcaactccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcagta
aagctggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggtaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagtacggaagtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcggggcataaatcatgcgctgaagtacagttgggatcagcttgagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
gccgcgctggtgaaatttgggtttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatataggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgatcgtttagttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system